DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-206

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_506033.1 Gene:nhr-206 / 187660 WormBaseID:WBGene00011097 Length:410 Species:Caenorhabditis elegans


Alignment Length:489 Identity:99/489 - (20%)
Similarity:181/489 - (37%) Gaps:127/489 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QSSEGSPDM-MDQKY-----NSVRLS-PAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFK 59
            :|:...||: :|::|     ||.:.. ...:||.:....|:||.:.:.|.||.:..|:||..||:
 Worm     4 ESNSFLPDIKVDERYCESTSNSQQSEITNETSRNVLPEKCEVCGNPAVGYHYDVATCNGCKAFFR 68

  Fly    60 RSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHE--------------- 109
            |::...|:.:|:.:|..|..::..:|..|..||..||.|||||..|::.|               
 Worm    69 RTVITGRRVICRRRKNCLVEMEPKNRRICPGCRFSKCEEVGMNPRAIRAEISSGGKILKDELIAK 133

  Fly   110 RGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEI--LMNTAALTGFPGVPMPMPGLPQRAGHHPAHM 172
            |.||:..:....:...:......::..|..:|  |.|::              ||...|......
 Worm   134 REPRSKIMLSPKSKENEVSRLISDLNLIENQIDELFNSS--------------LPINYGDWRTLS 184

  Fly   173 AAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAA 237
            ...|..|.      |.|.::|:..:.:..          |||          .|....|....|.
 Worm   185 EIIQMKPY------LKVSKIPNLKLIRNQ----------MNA----------ELAGYAHNGSLAM 223

  Fly   238 EHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQY----LMPMNFAQLLFVYES--- 295
                  |.:.|.:..|.::.....:.|::..   .|:.....:    :...|...|.|...|   
 Worm   224 ------VEYAKMLDFFPKISKETAIKLVKHG---LFMCGSLSFSRRSIQKYNSDILRFTDGSVAG 279

  Fly   296 ---ENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSI 357
               .|.|    |::.......|:.|:.:..:.:|..||..|:||:              :.|.::
 Worm   280 KPKTNWN----GVMLDHRRIAQKTLHSILRVKLDYVEYLFLKAIT--------------MCNPAV 326

  Fly   358 LTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPS--QPMRFQTLLGVVQLM--- 417
                    |...||.:.:::..:    .|.|:|.| ||..:.|..  ...||.::|.::.:|   
 Worm   327 --------SDFPAEDQKIIDKHR----FNYAQSLL-NYCLKQHGQIHGADRFASILSIMSIMEVQ 378

  Fly   418 --HKVSSFTIEELFFRKTIGDITIVRLISDMYSQ 449
              .:.|.|.:    ||....:..:  .:|.::.:
 Worm   379 QKEEKSCFFV----FRSIYSEFDV--FVSPLFDE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 34/106 (32%)
NR_LBD 215..436 CDD:416257 42/237 (18%)
nhr-206NP_506033.1 ZnF_C4 42..112 CDD:197701 26/69 (38%)
Glyco_hydro_30 <128..229 CDD:304972 22/146 (15%)
HOLI 216..376 CDD:214658 36/199 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158239
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.