DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-123

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_503207.2 Gene:nhr-123 / 187411 WormBaseID:WBGene00003713 Length:412 Species:Caenorhabditis elegans


Alignment Length:252 Identity:53/252 - (21%)
Similarity:92/252 - (36%) Gaps:55/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |::|.:.:.|||:|...|..||.||:|.....:...||.:.:  |...|.....|:.||:::|.:
 Worm    25 CQICENPAHGKHFGAITCRACAAFFRRFGISKKFKPCKLENK--CTFRKNGYFSCKKCRMQRCLQ 87

  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQ 163
            .||..|..|.:|.|          :|:..:    |:||          .:..|.|.|        
 Worm    88 FGMTIDNFQFDREP----------IYRKDL----EIPQ----------TVDTFSGRP-------- 120

  Fly   164 RAGHHPAHMAAFQPPPSAAA---VLDLS--VPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPT 223
                   .:..|..|..:::   .||:.  |.:.....::........|......|:..|.: ..
 Worm   121 -------SLILFSAPSGSSSSKHYLDVQFLVDKAIEVLLNGSETPLQVPNVLQKLAIGLRNI-RG 177

  Fly   224 PPLMAAEHIKETAAEHLF--------KNVNWIKSVRAFTELPMPDQLLLLEESWKEF 272
            |....::.|.:...|.:|        :...|:.....|..||...|:.:|:..|..|
 Worm   178 PKEKTSKVITKVGREEVFGIWEEDMLRTAKWLTYFDDFQRLPNSVQIEILKGVWSLF 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 26/82 (32%)
NR_LBD 215..436 CDD:416257 13/66 (20%)
nhr-123NP_503207.2 ZnF_C4 24..93 CDD:197701 22/69 (32%)
Hormone_recep 179..379 CDD:278530 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.