DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-282

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001370053.1 Gene:nhr-282 / 186200 WormBaseID:WBGene00010017 Length:253 Species:Caenorhabditis elegans


Alignment Length:161 Identity:41/161 - (25%)
Similarity:70/161 - (43%) Gaps:34/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 DQLLLLEESWKEF--FILAMAQYLMPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCH 322
            ||..:|::::.:.  |..|...||  :...||.|. :..|...|.:|:...|...|: ::.:.|.
 Worm    90 DQSFILQKNFVKVASFCEAFRYYL--LGEKQLTFP-DGSNILIEDLGIELGERIKFR-LVAKCCE 150

  Fly   323 LNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHND 387
            |.|.:.|: .|..:.:|     |:.:.|||::    ||:...:|..|..|..||:          
 Worm   151 LQITNEEF-LLLLVLIF-----SSPAIEDLSD----TGNLLLSSFQSYYSSSLLK---------- 195

  Fly   388 ARSALHNYIQRT-HPSQPMRFQTLLGVVQLM 417
                   |...| :...|:||..||.|.|::
 Worm   196 -------YCMLTFYQDGPIRFTKLLDVFQVV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537
NR_LBD 215..436 CDD:416257 41/161 (25%)
nhr-282NP_001370053.1 HOLI 71..219 CDD:214658 41/159 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.