DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-111

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_507060.2 Gene:nhr-111 / 185757 WormBaseID:WBGene00003701 Length:311 Species:Caenorhabditis elegans


Alignment Length:323 Identity:70/323 - (21%)
Similarity:123/323 - (38%) Gaps:108/323 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRN 86
            ||.::..|....|.||.|.|:|.|||:..|.||:|||:|::|....:.|.: ..|.||:||.:||
 Worm    30 PAQNNITLPITLCAVCGDTSNGNHYGVPTCFGCSGFFRRTVRNKLVHGCWN-GDGNCVIDKANRN 93

  Fly    87 QCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGF 151
            :|::||::|||:.||||:|||.||...:.|:               |..::|:....:...|   
 Worm    94 RCKSCRIKKCFKKGMNKNAVQPERTSHSYTV---------------EYVELPSFREYSKGLL--- 140

  Fly   152 PGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALA 216
                             |.|....:                     .|..|              
 Worm   141 -----------------PTHSDRLR---------------------FQHEH-------------- 153

  Fly   217 TRALPPTPPLMAAEHIKETAA--EHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQ 279
                        |:|..:|::  .||...:.|::....|..|...::..::...|.....||:.:
 Worm   154 ------------AQHEIDTSSVLVHLKNALQWVQQFSLFAVLSDVEKSQIILTQWPHLLCLALFE 206

  Fly   280 YLMPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKS 342
            .      ::.:|:.|.                 |.::..:...|.:.:.:|..|:.|.:|.::
 Worm   207 N------SEKIFIDEK-----------------FAQLAEKFKSLELSAQDYFLLKGIIIFTET 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 41/91 (45%)
NR_LBD 215..436 CDD:416257 19/130 (15%)
nhr-111NP_507060.2 NR_DBD_like 42..114 CDD:143512 36/72 (50%)
Glycosyltransferase_GTB_type 115..>256 CDD:299143 29/237 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001683
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.