DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-184

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001023926.1 Gene:nhr-184 / 185730 WormBaseID:WBGene00018415 Length:407 Species:Caenorhabditis elegans


Alignment Length:479 Identity:105/479 - (21%)
Similarity:176/479 - (36%) Gaps:133/479 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRN 86
            |||   :|...|||:|...:.|.|:|:.:|..||.||:|: .||.::..|:.:.|.|.:......
 Worm     2 PAA---LLISGPCKICDLPAHGNHFGVLSCRACAAFFRRA-SRSPRFQDKACEYGDCRIFDAGAY 62

  Fly    87 QCRACRLRKCFEVGMNKDAVQHER---GPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAAL 148
            :|:.|||:||::|||:....|.:|   ...|:.|:| ..:|         .||          :|
 Worm    63 RCKICRLKKCYKVGMDASKFQKDRDLISSSNAYLKR-TKVY---------APQ----------SL 107

  Fly   149 TGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSA--AAVLDLSVPRVPHHPVHQGHHGFFSPTA-- 209
            ..|.|              .|..:.:|:|..::  ..|:|::      ..||:....|....|  
 Worm   108 ANFLG--------------RPEFIISFEPEKASPFKTVIDVT------DLVHKAAEIFQEDLANS 152

  Fly   210 ----AYMNALATRALPPTPPLMAAEHIKETAAEHLFKNV--------------------NWIKSV 250
                .|.|:|....|       ..|.::..::.|..|.|                    ||...:
 Worm   153 PMPYKYSNSLEKLTL-------EMEDLRLRSSNHKVKIVRNIGKAESLVFFEQMFLATANWYARL 210

  Fly   251 RAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVYESENANREIMGMVTREVHAFQE 315
            ..||.|.:..:|.:|:.:|              |.:.:|..:.|:.. |:.|..|........:.
 Worm   211 PDFTSLDLRVKLEILKSTW--------------MLWIRLNKLAETAQ-NQRIKEMGANIFMCSEN 260

  Fly   316 VLNQLCHLNID---STEY--ECLRAISLFRKSPPSASSTEDLANSS-------------ILTGSG 362
            ....:..:|:|   .|.|  |.::|..:...........|||...:             .|..:|
 Worm   261 TCLNVQDINVDWSWCTNYGAEQMQAFLMPNIDKHWRQPVEDLVKLNPTDMELNFMLIQLCLNDAG 325

  Fly   363 SPNSSASAESRGLLESGKVAAMHNDARSALHNYIQR--THPSQPMRFQTLLGVVQLMHKVSSFTI 425
            .     ..:.|.|..:.|:..::.|   .||||..:  ..||...|...|:       |::....
 Worm   326 K-----KFQGRVLEATDKLLQINAD---NLHNYYTKKLNMPSYSGRLTKLM-------KINQIVE 375

  Fly   426 EELFFRKTIGDIT-IVRLISDMYS 448
            |::..||....|. :..|.|.:||
 Worm   376 EDVRERKEKAKIVEVFDLFSIVYS 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 31/94 (33%)
NR_LBD 215..436 CDD:416257 47/260 (18%)
nhr-184NP_001023926.1 ZnF_C4 10..80 CDD:197701 27/70 (39%)
Hormone_recep 177..384 CDD:278530 44/236 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.