DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-30

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_505343.2 Gene:nhr-30 / 182887 WormBaseID:WBGene00016091 Length:416 Species:Caenorhabditis elegans


Alignment Length:280 Identity:57/280 - (20%)
Similarity:108/280 - (38%) Gaps:73/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVC-KSQKQGLCVVDKTHRNQCRAC 91
            :::...||:|...:.|.|:|:.||..||.||:|.:..:.:|.| |.:.:  |.::|..|:.||.|
 Worm    15 MMHRSTCKICGLAAHGVHFGVTACRACAAFFRRFVVLNLEYECLKDEIK--CNLNKIRRSSCRHC 77

  Fly    92 RLRKCFEVGMNKDAVQHERGPRNSTLR-RHMAMYK--------------DAMMGAGEMPQIPAEI 141
            |.:||..:||..|.||..|...::.:| |.:.:.:              :::......|.|..|.
 Worm    78 RFQKCLRMGMTADNVQWNRDVYSNEMRYRKLKIQEIRNDENDASIAYPCNSLPSTSLYPVIKTED 142

  Fly   142 LMNTAAL---TGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPH------HPV 197
            .:.|.::   ..:..:...|         |...|:              .:|...|      .|:
 Worm   143 QLYTKSVLSEINYENLERDM---------HKMFMS--------------DIPSTDHGYFASLSPI 184

  Fly   198 HQGHHGF---------FSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAF 253
            :|...|.         |.  ..:.|.|:...|.|        |.:|.|......:::.:    ||
 Worm   185 YQVVEGLRLIRKSQQTFD--IQFENRLSLETLVP--------HWREQAKNTAIMSMHSM----AF 235

  Fly   254 TELPMPDQLLLLEESWKEFF 273
            ..:|:.::..:.:..|:..:
 Worm   236 RNIPLTEKSRIFKSLWQNIY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 31/89 (35%)
NR_LBD 215..436 CDD:416257 10/59 (17%)
nhr-30NP_505343.2 ZnF_C4 20..90 CDD:197701 27/71 (38%)
Hormone_recep 199..400 CDD:333840 12/71 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.