DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-149

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_504874.2 Gene:nhr-149 / 182174 WormBaseID:WBGene00015397 Length:375 Species:Caenorhabditis elegans


Alignment Length:443 Identity:89/443 - (20%)
Similarity:152/443 - (34%) Gaps:113/443 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHR-----NQCRACRL 93
            |.:|...:.|.||.:.:|.||..||:|......:.:|....:  | .|...|     ::|||||.
 Worm     7 CSICSRPAQGYHYDVISCKGCKTFFRRMWLSKIKEMCPLNNK--C-FDFNRRINMSLSKCRACRF 68

  Fly    94 RKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPM 158
            ::|..||||..|:|.:..|:..:     :.::|       ...|..:|......||   .|.:.:
 Worm    69 QRCLNVGMNPAAIQCDGNPKKDS-----SHFRD-------FDSIDEKIKNIIDTLT---YVELKL 118

  Fly   159 PGLPQRAGHHPAHMAAFQPPPSAAAVLD--------LSVPRVPHHPVHQGHHGFFS---PTAAYM 212
            ...         ..:|:.|..|.:..||        ||:..: :.|:.....||..   |:::..
 Worm   119 ENY---------RKSAYNPVLSLSTGLDDLIEGSCSLSLAEI-YGPMSGWPLGFEEHQLPSSSMR 173

  Fly   213 NALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAM 277
            |.......|       ..:.|.....::...:.:.|:.:.|.||...|:.:|...:......|.:
 Worm   174 NVSCEEPCP-------VSNRKYWTHCNMLTTIEYFKTFKFFHELSSRDKFVLARHTLLLCQNLHI 231

  Fly   278 AQYLMPMNFAQLL----FVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISL 338
            :.|.:..||...|    .:...::.....:.|::         :..|....|...||..|:||..
 Worm   232 SHYTVSHNFDSCLQPDGSMQPKQDERHYPIAMMS---------IEPLVRCKIQHVEYVLLKAICF 287

  Fly   339 FRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQ 403
            ...:.|..|...    ..||           |:.|...            ...|.|:..|.:...
 Worm   288 CNPAVPELSQNA----QRIL-----------AKERYCF------------ADILINHCLRNYTDG 325

  Fly   404 PMRFQTLLG-------------------VVQLMHKVSSFTIEELFFRKTIGDI 437
            |..|..|:|                   ||.||:|   |:.|.:.|...:.|:
 Worm   326 PGHFAELIGIFNLLETQQRMFKDLHIMYVVPLMNK---FSRELIKFLSDVMDV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 28/87 (32%)
NR_LBD 215..436 CDD:416257 42/243 (17%)
nhr-149NP_504874.2 ZnF_C4 6..78 CDD:197701 24/73 (33%)
HOLI 190..342 CDD:214658 32/187 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158225
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.