DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and daf-12

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001024547.1 Gene:daf-12 / 181263 WormBaseID:WBGene00000908 Length:753 Species:Caenorhabditis elegans


Alignment Length:406 Identity:95/406 - (23%)
Similarity:149/406 - (36%) Gaps:111/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GSPD--MMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQY 68
            ||||  ::|....|.|....          |:||.||::|.::.:..|:.|..||:|:..|.:::
 Worm    98 GSPDDGLLDSSEESRRRQKT----------CRVCGDHATGYNFNVITCESCKAFFRRNALRPKEF 152

  Fly    69 VCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHE---RGPRNSTLRRHMAMYKDAMMG 130
            .|...:.  |.::...|..|:.|||||||.|||.|:.:.:|   |..:||.|.......|.:..|
 Worm   153 KCPYSED--CEINSVSRRFCQKCRLRKCFTVGMKKEWILNEEQLRRRKNSRLNNTGTCNKRSQPG 215

  Fly   131 AGEMPQIPAEILMNTAALTGFPGVPM--PMPGLP-------QRAGHH-----PAHMAAF------ 175
            ..:.||.|.:   ........|||.:  |.|..|       .:..||     |..|...      
 Worm   216 NQQSPQGPNQ---QPHLSPHHPGVAIYPPQPQRPLTINPMDNQMMHHMQANRPNAMPQLISPPGA 277

  Fly   176 QPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHL 240
            ||.|..:.|...:....|:..:...|:|..||.....|.:|.||.||                  
 Worm   278 QPYPLTSPVGSSASDSPPNRSLTMMHNGEKSPDGYDPNIMAHRAPPP------------------ 324

  Fly   241 FKNVNWIKSVRAFTELPMPD--QLLLLEESWKEFFILAMAQYLMPMNFAQLLFVYESENANREIM 303
                       :|...|..|  |::|..|.:|                 |||    |.....::.
 Worm   325 -----------SFNNRPKMDSGQVVLSTEEYK-----------------QLL----SRIPGAQVP 357

  Fly   304 GMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSA 368
            |::..|     |.:|:       ...|.|.........:||.::...|::.|       ..||::
 Worm   358 GLMNEE-----EPINK-------RAAYNCNGHPMPAETTPPYSAPMSDMSLS-------RHNSTS 403

  Fly   369 SAESRGLLESGKVAAM 384
            |...:..:....|:|:
 Worm   404 SGTEKNHMTHSTVSAI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 31/94 (33%)
NR_LBD 215..436 CDD:416257 31/172 (18%)
daf-12NP_001024547.1 NR_DBD_CAR 116..209 CDD:143524 32/104 (31%)
NR_LBD_F1 548..733 CDD:132727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.