DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and fax-1

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_508547.1 Gene:fax-1 / 180609 WormBaseID:WBGene00001400 Length:419 Species:Caenorhabditis elegans


Alignment Length:340 Identity:97/340 - (28%)
Similarity:140/340 - (41%) Gaps:105/340 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKS 72
            |.|...|.:|   .|.|||..|.   |.||.|.||||||||.||:||:||||||:||...|.|::
 Worm    82 PSMGSVKTDS---PPTASSPTLC---CAVCGDVSSGKHYGILACNGCSGFFKRSVRRRLIYRCQA 140

  Fly    73 QKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRN-STLRRHMAMYKDAMMGAGEMPQ 136
             ..|.|||||.|||||:||||:||...||||||||:||.||| :|:|                  
 Worm   141 -GTGNCVVDKAHRNQCQACRLKKCLNKGMNKDAVQNERQPRNTATIR------------------ 186

  Fly   137 IPAEILMNTAALTGFPGVPM-PMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQG 200
                           |.:.| |.....:.||             :.:|::              |
 Worm   187 ---------------PALDMDPQNFFREYAG-------------AVSAIM--------------G 209

  Fly   201 HHGFF----SPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQ 261
            |....    ||::|........         ..:.::||....|...:.|.:..|.||.|...::
 Worm   210 HSNMMKREDSPSSASDGKTEDE---------KKDSLQETTMSQLESVLQWAQQFRLFTVLTNSEK 265

  Fly   262 LLLLEESWKEFFILAMAQYLMPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNID 326
            ..::...|.....:::.:....::|...|                       ..::.:...|::.
 Worm   266 RQIILTQWPRLLCISLCEQAEDVSFDDHL-----------------------TSLMLKFRRLDVS 307

  Fly   327 STEYECLRAISLFRK 341
            ..|:.||:||::|.|
 Worm   308 PAEFNCLKAITIFMK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 59/92 (64%)
NR_LBD 215..436 CDD:416257 19/127 (15%)
fax-1NP_508547.1 NR_DBD_PNR 94..185 CDD:143528 60/94 (64%)
NR_LBD 243..>320 CDD:386099 15/99 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001683
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X118
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.