DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-115

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001256014.1 Gene:nhr-115 / 178708 WormBaseID:WBGene00003705 Length:391 Species:Caenorhabditis elegans


Alignment Length:394 Identity:86/394 - (21%)
Similarity:132/394 - (33%) Gaps:146/394 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQ--CR 89
            ::|:  ||::|..:|.|.|:||.:|..||.||:||:.      .|..::| |:.:...:..  |:
 Worm     3 KVLF--PCQICGQNSHGTHFGIVSCRACAAFFRRSVN------SKWARKG-CLTNFKDKGSCFCK 58

  Fly    90 ACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGV 154
            .||||||.|:||:....|::|               || :.|.:.|:|             ||.|
 Worm    59 PCRLRKCVEIGMDASKFQYDR---------------DA-ISAIKHPKI-------------FPSV 94

  Fly   155 PMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDL-----SVPRVPHH----PVHQGHH------GF 204
            ...: |.|:......:::.      |....:|:     .|.|...|    |::..:.      ||
 Worm    95 SYYV-GRPEFLMFSDSNVT------SQKTFIDVQNLVFEVSRYLDHGCETPIYAENQLKKLTLGF 152

  Fly   205 FSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNV-NWIKSVRAFTELPMPDQLLLLEES 268
            ......|.|      :.....:..||.|  ...|:.|..| .||.....|.:|....|:.||:..
 Worm   153 KLMQFDYQN------VKFFDKIGKAEFI--DIIEYYFLTVAKWIAHFDEFRKLDQSLQIKLLQAI 209

  Fly   269 WK--------------------------------------------------------------- 270
            |.                                                               
 Worm   210 WHVWSKIHKCASTAFYRKSNPNAKPTQKILRNVCMDRMHVHKLDTSWMSDYPTEHVTRFMLTHHV 274

  Fly   271 -EFFILAMAQYLMPMN------FAQLLFVYESENANREIMGMVTREVHAFQEVL-NQLCHLNIDS 327
             :|.|:.....|.|.:      ||||.|.|    |.:...|.:.:....||:|| |.|.|..|..
 Worm   275 YDFKIVESLLKLDPTDVELTFMFAQLCFEY----AGKRFQGEILKITDHFQQVLSNDLHHYYITD 335

  Fly   328 TEYE 331
            ...|
 Worm   336 QRRE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 31/91 (34%)
NR_LBD 215..436 CDD:416257 35/189 (19%)
nhr-115NP_001256014.1 ZnF_C4 7..73 CDD:197701 28/72 (39%)
Hormone_recep 160..365 CDD:278530 36/192 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.