DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-18

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_503608.2 Gene:nhr-18 / 178702 WormBaseID:WBGene00003617 Length:394 Species:Caenorhabditis elegans


Alignment Length:468 Identity:89/468 - (19%)
Similarity:167/468 - (35%) Gaps:144/468 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIR-RSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCF 97
            |:||.|.:||:|:|:.:|..||.||:|:.. ...:.:|.:   |.|......:..|:.|||:||.
 Worm    11 CEVCGDKTSGRHFGVMSCRACAAFFRRAATWNLEKRICPN---GTCHTSVNGKFNCKQCRLKKCL 72

  Fly    98 EVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLP 162
            :|||:....|.:|.                ::....:.|          :|..|.|         
 Worm    73 DVGMDTRRFQTDRD----------------LISCSAISQ----------SLATFLG--------- 102

  Fly   163 QRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLM 227
                 .|..:...:|..::.....:.|.|:                   :|........||..::
 Worm   103 -----RPEFILCCEPDRASVLKTTIDVTRL-------------------VNIARDMLQKPTNHVL 143

  Fly   228 AAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLE--ESWKEFFILAMAQYLMPMNFAQLL 290
            .:..:     |.|...::.::.|.:..|:...::...:|  :||::.|:..:..:   .||::..
 Worm   144 PSNSL-----EQLATTLDNMRCVESNKEVKFIEKYGKVETLKSWEQGFLRVVEWF---SNFSEFR 200

  Fly   291 FVYE--------------------SENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYE---C 332
            .:.|                    ||.||::|..|:.:.    |.::.....:|:::.|.:   |
 Worm   201 ELNERLKLEIVKSCWFSWTRLDKLSETANKQINKMLGKS----QLMVGNGACMNMNNFEIDLSWC 261

  Fly   333 ----LRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALH 393
                |..:..|.::|....:.:......|.....|...|.......|..:||  .:|.||..|..
 Worm   262 TNYSLEQLKYFFQTPNGKKNFQQSIQDMIDLNPSSIEVSYMLLHLSLEHAGK--RLHGDALDATE 324

  Fly   394 NYIQRTHPSQPMRFQTLLGVVQL--MHKVSSFTIEEL--------------FFRKTIGDITI--- 439
            |.:|                ||.  :||   :.:|:|              ..|....||.|   
 Worm   325 NLVQ----------------VQANNLHK---YYVEKLKLANYSSRLTQLMRITRTLEADIRIRIE 370

  Fly   440 VRLISDMYSQRKI 452
            .:.|:|:::..||
 Worm   371 KKQIADVFNIMKI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 28/83 (34%)
NR_LBD 215..436 CDD:416257 45/265 (17%)
nhr-18NP_503608.2 NR_DBD_like 11..86 CDD:295381 27/77 (35%)
Hormone_recep 163..371 CDD:278530 43/235 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.