DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-103

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_503607.1 Gene:nhr-103 / 178701 WormBaseID:WBGene00003693 Length:394 Species:Caenorhabditis elegans


Alignment Length:454 Identity:90/454 - (19%)
Similarity:159/454 - (35%) Gaps:135/454 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYV-CKSQKQGLCVVDKTHRNQCRACRLRKC 96
            ||::|...:||:|:|:.:|..||.||:||...||:.| |   .:|.|.:.:..:..|:.|||:||
 Worm    10 PCEICGQKTSGRHFGVLSCRSCAAFFRRSATWSRKKVQC---VKGTCKIFEDGKFNCKQCRLKKC 71

  Fly    97 FEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGL 161
            .||||:....|..|.                ::.:..:||          :|..|.|        
 Worm    72 VEVGMDSKKFQTNRD----------------LISSCSVPQ----------SLCNFLG-------- 102

  Fly   162 PQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTP-- 224
                  .|..:...:|..::.....:.|                    .|:..:|...|...|  
 Worm   103 ------RPEFILCCEPDKASVFKTTIDV--------------------TYLVDMAKNLLEKDPCQ 141

  Fly   225 -PLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQ 288
             ||..:.....|..|:: :.:...|..:...:|...:.|    ::|::.|:.|:..:   .||::
 Worm   142 CPLSNSLEQLSTTLENM-RGMKLNKETQIIKKLGKNESL----KTWEQGFLRAVEWF---SNFSE 198

  Fly   289 LLFVYE--------------------SENANREIMGMVTREVHAFQEVLNQLC-HLNIDSTEYE- 331
            ...:.|                    ||.||:.:...:.   ::...|.|..| |:|    :|| 
 Worm   199 FRELDENLKMEILKTCWVSWIRLDKLSETANKRVNATLD---NSLLMVGNDSCMHMN----DYEV 256

  Fly   332 ----C----LRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGK-------- 380
                |    |..::.|..:|....:...|....:.....|...|.......|..:||        
 Worm   257 DLSWCTNYSLEQLAFFFLTPDDEKNYRQLIQDMVDLNPSSTEISYMLLQLSLEHAGKRLQGDILE 321

  Fly   381 -----VAAMHNDARSALHNYIQR--THPSQPMRFQTLLGVVQLMHKVSSFTIEELFFRKTIGDI 437
                 |.|..|.    ||:|..:  ...:...|...|:.:.:.:.......||    :|.:.|:
 Worm   322 ATESLVQAQANQ----LHDYYAKKLKLSNYSSRLTQLMKITRTLEADMRLRIE----KKKVADV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 32/84 (38%)
NR_LBD 215..436 CDD:416257 48/268 (18%)
nhr-103NP_503607.1 ZnF_C4 10..77 CDD:197701 29/69 (42%)
Hormone_recep 164..371 CDD:278530 40/228 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.