DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-90

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_503263.1 Gene:nhr-90 / 178577 WormBaseID:WBGene00003680 Length:393 Species:Caenorhabditis elegans


Alignment Length:394 Identity:75/394 - (19%)
Similarity:113/394 - (28%) Gaps:178/394 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVC-RDHSSGKHYGIYACDGCAGFFKRSIRRSRQYV---CKSQKQGLCVVDKTHRNQCRACRLR 94
            ||:| .:::.|.|:|:..|..||.||:|  |...:|:   |.|...|...      ..|:.|||:
 Worm     9 CKICGAENTRGNHFGVQCCRACAVFFRR--RAGTKYLRLKCLSVHCGEAA------RFCKPCRLK 65

  Fly    95 KCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMP 159
            :|:|.||..:..||.|....|:                .:.|||...    |.:.|.|.      
 Worm    66 RCYEAGMKIEYFQHNRDSIKSS----------------SIAQIPRSF----ANIVGRPS------ 104

  Fly   160 GLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRA----- 219
                        :..|..|..:                       :..|...:|:|..:|     
 Worm   105 ------------LVIFCVPQDS-----------------------YQKTFVDLNSLVGKASEIFT 134

  Fly   220 LPPTPPLMAAEHIKETA---------AEHLFKNVN-----------------WIKSVRAFTELPM 258
            ..|..|.:....:|:.|         |:..||.::                 |:.....|..:|.
 Worm   135 AGPESPYIGLTQLKKLATFSNCSKEWAQTRFKTISHGEMSYFWEFYFLRTAKWLTYFDEFQRIPD 199

  Fly   259 PDQLLLLEESWKEFFIL--------------------AMAQYL---------------------- 281
            ..::.||...|..|..|                    ||:..|                      
 Worm   200 EIKIKLLLSFWHVFARLDKLITTAKARKLKLCSQQTWAMSNGLILDFDRTKVDFSDISNYPTEDL 264

  Fly   282 --------------------------MPMNF--AQLLFVYESENANREIMGMVTREVHAFQEVLN 318
                                      |..||  |||.|.|    |.:...|.:.:....|||||:
 Worm   265 FYFLNSITALDLQPQVLELMELEVSDMEFNFMLAQLTFSY----AGKRFQGDILKICDRFQEVLS 325

  Fly   319 QLCH 322
            ...|
 Worm   326 NDLH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 29/86 (34%)
NR_LBD 215..436 CDD:416257 36/209 (17%)
nhr-90NP_503263.1 ZnF_C4 8..75 CDD:197701 25/73 (34%)
Hormone_recep 158..365 CDD:278530 30/176 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.