DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-98

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001300155.1 Gene:nhr-98 / 178568 WormBaseID:WBGene00003688 Length:453 Species:Caenorhabditis elegans


Alignment Length:445 Identity:93/445 - (20%)
Similarity:151/445 - (33%) Gaps:142/445 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SPDMMDQKY----NSVRLSPAASSRILYHV-----------------------------PCKVCR 38
            |..|:..||    |...:|.||.:.|..|:                             .|::|.
 Worm     4 SQTMVQNKYMQLKNQKIMSAAARTFISIHIGVCFDEMDSPGSSAPSPPDLTIIPKISSKKCQICE 68

  Fly    39 DHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNK 103
            :.:.|||:|...|..||.||:|....:....||::.:  |...|.....|:.||:::|.:.||..
 Worm    69 NPAHGKHFGAVTCRACAAFFRRFGISNNFKPCKTENK--CSFRKNGYFSCKKCRMQRCLQFGMTI 131

  Fly   104 DAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHH 168
            |..|.:|.|.| .|:.::.:.:.....:|.    |:.||.:..:.:..|...:.:..|..||.. 
 Worm   132 DNFQFDREPFN-PLKMNVGIPQTVDTFSGR----PSLILFSAPSGSSGPKRYIDVQFLVDRAVE- 190

  Fly   169 PAHMAAFQPPPSAAAVLD-----LSVPRVPHHPVHQ-----GHHGFFSPTAAYMNALAT------ 217
             ..:...:.|...:.||.     |...|.|...|.|     |..|.|......|..:|.      
 Worm   191 -VLLNGSETPYQVSNVLQKLAIGLQNIRGPQQKVSQIVTKIGKEGIFKLWEEEMLRMAKWLTYFD 254

  Fly   218 --RALPPTPPLM----------AAEHIKETAAEH-------------LFKNV------------N 245
              :.||.:..:.          ..|:|..||...             :.|||            :
 Worm   255 DFQRLPHSVQIEILNGVWFLFGRLENIASTALARKRKLCKDDMVMTCVNKNVLICDLRTLEIDLS 319

  Fly   246 WIKSVRAFTELPMPDQ-------------LLLLEESWKEFFILAMAQYLMPMNFAQLLFVYESEN 297
            |. |...|.:|...||             :|.||.:.:|.      .|::    .||.|    ..
 Worm   320 WC-SKYTFQQLKFFDQYDDLRQLDILINAMLDLEPTHEEL------SYMI----CQLCF----HQ 369

  Fly   298 ANREIMGMVTREVHAFQEVLNQLCH-------------------LNIDSTEYECL 333
            ..:::.|.:.:.|...||||:...|                   :.|::|..:||
 Worm   370 VGKKLQGNILKTVEKLQEVLSNNLHDYYVNQMNQPKYSKRIARMMKINNTVEQCL 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 29/120 (24%)
NR_LBD 215..436 CDD:416257 35/194 (18%)
nhr-98NP_001300155.1 ZnF_C4 63..132 CDD:197701 22/70 (31%)
Hormone_recep 220..430 CDD:278530 41/220 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.