DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-100

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_501731.1 Gene:nhr-100 / 177806 WormBaseID:WBGene00003690 Length:437 Species:Caenorhabditis elegans


Alignment Length:383 Identity:87/383 - (22%)
Similarity:152/383 - (39%) Gaps:120/383 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MDQKYNSVRLSPAASSRILYHVP-------CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQY 68
            |:..:|||       |:|.:..|       |.||.|....:|||..:|:||.|||:|||...|.|
 Worm     1 MNIPFNSV-------SKIQWRNPSPVSDTSCLVCGDPHGKRHYGAMSCNGCKGFFRRSIWEKRTY 58

  Fly    69 VCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNST---------LRRHMAMY 124
            .|....:  |:::..:||:||||||::|..|||:.:||:.||..:..|         ::...|..
 Worm    59 KCSFNNE--CIIEFKYRNRCRACRLKRCLHVGMDANAVRSERTRKIKTEIDGDVKLEIKEEPADS 121

  Fly   125 KDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSV 189
            :||      ..:.|.:|.         |.:.|                 |:|.....|.:| ...
 Worm   122 EDA------DDECPLDIK---------PDIAM-----------------AWQTKEIIAHML-YEE 153

  Fly   190 PRV-----PHHPVHQGHHGFFSPTAAYMNAL--ATRALPPTP--------PLMAAEHIKETAAEH 239
            .||     |::.:.     :::..:..:.|:  .::....|.        ||:..|.::......
 Worm   154 DRVLNWEEPYNKLR-----YYTMDSEVLQAIKDPSQVCARTKINWNSHSRPLITIEALRFNWCRT 213

  Fly   240 LFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVYES--------- 295
            ....::|.:::..:..|...|:.||::.|            |||:.:  |.:.|:|         
 Worm   214 FTLTIDWFETLPEYRALIDDDKELLVKFS------------LMPVGW--LWYAYKSYEYRCDGIV 264

  Fly   296 ----------ENANREI-------MGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAI 336
                      :...:::       .|.:|....|  :|:|.:..|.:|.||...|:||
 Worm   265 FVDGSWFPRDKTIQQQVCPTCVLYYGRITESFMA--DVVNSMKELEMDETEMVLLKAI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 40/107 (37%)
NR_LBD 215..436 CDD:416257 28/158 (18%)
nhr-100NP_501731.1 NR_DBD_HNF4A 24..98 CDD:143518 34/75 (45%)
HOLI 210..376 CDD:214658 24/127 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.