DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-92

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_500111.3 Gene:nhr-92 / 176971 WormBaseID:WBGene00003682 Length:354 Species:Caenorhabditis elegans


Alignment Length:441 Identity:87/441 - (19%)
Similarity:158/441 - (35%) Gaps:142/441 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |:||...|:..|:|...|..|:.||:|::.|..:|.||..:.  |::..|.||.|:.||..||..
 Worm     5 CQVCGVPSARIHFGGVVCSACSAFFRRTVVRGHEYRCKQMEN--CLIVSTIRNMCKKCRYTKCIL 67

  Fly    99 VGMNKDAVQHER---GPRNSTLRRH----MAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPM 156
            |||.:::||..|   |.|..|::..    ..:.||.:.....:..:                   
 Worm    68 VGMKRESVQKFRDVYGKREITVKNSTKTASPILKDFVKNYEHLENV------------------- 113

  Fly   157 PMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALP 221
                  :|..|.          .::.:|.....||    ||:...              ||:.| 
 Worm   114 ------RRVIHR----------DNSRSVFAKEAPR----PVNYKE--------------ATKVL- 143

  Fly   222 PTPPLMAAEHIKETAAEHLFKNV-NWI-KSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPM 284
                      :||      ||.| :|| .|.|.|:|||...:..||...:.:|.||....:....
 Worm   144 ----------LKE------FKLVKDWINNSFREFSELPDDQKTTLLHNFYLQFIILEGGYFACQY 192

  Fly   285 NFAQLLFV--------------YESENANREIMGMVTREVHAF------QEVLNQLCHLNIDSTE 329
            ....:.::              |...:..:.|..:...::.|.      :.|.:.:..:..|..|
 Worm   193 GRTDITYLPSGDYIDCVNPETYYHDPDGQQPISEVEASKMFASSFDTYRRNVYDPMIRIACDKFE 257

  Fly   330 YECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSAL-H 393
            :..|.|::||.                  ||....:...:...|.:.||.:        |..| :
 Worm   258 FLALTALTLFD------------------TGLEGQSDQCTESCRRIRESVQ--------REVLQY 296

  Fly   394 NYIQRTHPSQPMRFQTLLGVV-------QLMHK-------VSSFTIEELFF 430
            :.:.|:.....:|...:|.::       |..|:       :::::::|:|:
 Worm   297 SKLTRSELDSSIRLGDILSILPNLQRATQRFHEDMTISNVMNAYSVDEIFY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 32/85 (38%)
NR_LBD 215..436 CDD:416257 45/253 (18%)
nhr-92NP_500111.3 ZnF_C4 5..73 CDD:197701 27/69 (39%)
Hormone_recep 129..330 CDD:278530 47/261 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.