DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-109

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001368017.1 Gene:nhr-109 / 173780 WormBaseID:WBGene00003699 Length:367 Species:Caenorhabditis elegans


Alignment Length:417 Identity:86/417 - (20%)
Similarity:143/417 - (34%) Gaps:125/417 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.:|::...|.|:|..||..||.||:|||..::.|.|.....  |.|....|..||||||.||.|
 Worm    13 CSICQESGDGFHFGAEACRACAAFFRRSISENKLYTCSGNND--CDVTVNIRCMCRACRLTKCIE 75

  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIP--AEILMNTAALTGFPGVPMPMPGL 161
            ||||...|:.:.|    :.|:...:...:.....|..::|  :::.:|      :..:......|
 Worm    76 VGMNPVGVRQKPG----SFRKSKELISPSSSNHDEFSRMPILSKMKLN------YENMRNARKAL 130

  Fly   162 PQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHH--PVHQGHHGFFSPTAAYMNALATRALPPTP 224
            ....|.:               |.:..:|:..::  .|.||...:              .|.|  
 Worm   131 HNEVGEN---------------VFEEKIPKEINYKESVQQGMKDY--------------TLMP-- 164

  Fly   225 PLMAAEHIKETAAEHLFKNVNWIKS-VRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMN--- 285
                                .|:.| ...|..|....:.:|...|:..||::..| :|..:|   
 Worm   165 --------------------EWVSSCFDEFRTLSADQKNILFRNSYIPFFMMETA-FLSHINNMP 208

  Fly   286 ------------FAQLLFVYESENANREIMGMVTREVHAF---------QEVLNQLCHLNIDSTE 329
                        ...|...|.|.|..::|.   |.::...         :.:|..:.:|.:|.  
 Worm   209 DSVIFPSGDYCDMKNLERYYNSTNFEKKIS---TEDIENLFKPFYDNYKRSLLLPMMNLQVDI-- 268

  Fly   330 YECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESG-KV-AAMHNDARSAL 392
            ||.|...:|..........|::                       .||.| || |.:..:....|
 Worm   269 YEFLTLFTLLHWDTGLVEITDE-----------------------CLEIGTKVKAEVFKELDFYL 310

  Fly   393 HNYIQRTHPSQPMRFQTLLGVVQLMHK 419
            .|..:...||  :|..|::.::..:||
 Worm   311 TNVKKVAEPS--VRIGTIVNLLPAVHK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 34/82 (41%)
NR_LBD 215..436 CDD:416257 41/232 (18%)
nhr-109NP_001368017.1 ZnF_C4 12..80 CDD:197701 31/68 (46%)
Hormone_recep 140..349 CDD:395054 45/263 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.