DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Nr3c1

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_006525721.1 Gene:Nr3c1 / 14815 MGIID:95824 Length:793 Species:Mus musculus


Alignment Length:465 Identity:113/465 - (24%)
Similarity:178/465 - (38%) Gaps:118/465 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSEG-SPDMMDQKYNSVRLSPAASSRILYHVP---CKVCRDHSSGKHYGIYACDGCAGFFKRSIR 63
            ||.| .||:.         ||.:||......|   |.||.|.:||.|||:..|..|..||||::.
Mouse   411 SSPGMRPDVS---------SPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVE 466

  Fly    64 -RSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDA 127
             |...|:|..:..  |::||..|..|.|||.|||.:.|||.:|            |:.....|..
Mouse   467 GRQHNYLCAGRND--CIIDKIRRKNCPACRYRKCLQAGMNLEA------------RKTKKKIKGI 517

  Fly   128 MMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRV 192
            ......:.|..:|....|.       ||..:|                |..|:..::|::..|.|
Mouse   518 QQATAGVSQDTSENANKTI-------VPAALP----------------QLTPTLVSLLEVIEPEV 559

  Fly   193 PHHPVHQGHHGFFSPTAAY-----MNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRA 252
                ::.|:.... |.:|:     :|.|..|      .::||              |.|.|::..
Mouse   560 ----LYAGYDSSV-PDSAWRIMTTLNMLGGR------QVIAA--------------VKWAKAIPG 599

  Fly   253 FTELPMPDQLLLLEESWKEFFILAMA----QYLMP----MNFAQLLFVYESENANREIMGMVTRE 309
            |..|.:.||:.||:.||  .|::|.|    .|...    :.||..|.:    |..|..:..:..:
Mouse   600 FRNLHLDDQMTLLQYSW--MFLMAFALGWRSYRQASGNLLCFAPDLII----NEQRMTLPCMYDQ 658

  Fly   310 VHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILT-------------GS 361
            ......:..:|..|.:...||.|::.:.|....|.....:::|.:...:|             |:
Mouse   659 CKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGN 723

  Fly   362 GSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRT--HPSQPMRFQTLLG--VVQLMHKVSS 422
            .|.|.....:...||:|     || |....|.:|..:|  ..|..:.|..:|.  :...:.|.|:
Mouse   724 SSQNWQRFYQLTKLLDS-----MH-DVVENLLSYCFQTFLDKSMSIEFPEMLAEIITNQIPKYSN 782

  Fly   423 FTIEELFFRK 432
            ..|::|.|.:
Mouse   783 GNIKKLLFHQ 792

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 36/95 (38%)
NR_LBD 215..436 CDD:416257 53/243 (22%)
Nr3c1XP_006525721.1 GCR 27..418 CDD:366943 3/6 (50%)
NR_DBD_GR_PR 433..511 CDD:143546 35/91 (38%)
NR_LBD_GR 547..793 CDD:132761 60/283 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.