DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and AgaP_AGAP012600

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_307453.3 Gene:AgaP_AGAP012600 / 1268880 VectorBaseID:AGAP012600 Length:202 Species:Anopheles gambiae


Alignment Length:224 Identity:64/224 - (28%)
Similarity:106/224 - (47%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 EHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVYE 294
            |.|.||:|..||..|.|.|::.:|..|...||::||||||.|.|:|...|:.||::.........
Mosquito     6 ETIYETSARLLFMAVKWAKNLPSFASLTFRDQVILLEESWAELFLLNAIQWCMPIDTTACTLFSL 70

  Fly   295 SENANRE------IMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLA 353
            :|:.|..      ..|.|...:....:.|.:...:.:|..|:.|::||.|||             
Mosquito    71 NEHCNSANNSGFFKPGQVNDNLRILNDTLCRFKSVLVDPAEFACMKAIVLFR------------- 122

  Fly   354 NSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTLLGVVQLMH 418
                            :|:|||.:..::..:.:.|:..|..:.:...|.|..||..||.::.|:.
Mosquito   123 ----------------SEARGLKDPVQIENLQDQAQVMLAQHSRTQFPGQIARFGRLLLMLPLLR 171

  Fly   419 KVSSFTIEELFFRKTIGDITIVRLISDMY 447
            .|:|..||.::|:||||:..:.:::.|||
Mosquito   172 AVNSHKIESIYFQKTIGNTPMEKVLCDMY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537
NR_LBD 215..436 CDD:416257 60/211 (28%)
AgaP_AGAP012600XP_307453.3 NR_LBD 6..189 CDD:299703 60/211 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D373206at33208
OrthoFinder 1 1.000 - - FOG0001683
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.