DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and esrrb

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_017951897.2 Gene:esrrb / 100494008 XenbaseID:XB-GENE-483510 Length:441 Species:Xenopus tropicalis


Alignment Length:436 Identity:95/436 - (21%)
Similarity:172/436 - (39%) Gaps:104/436 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SPAASSRILYHVP---CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDK 82
            |||.:...:...|   |.||.|.:||.|||:.:|:.|..||||:|:.:.:|.|.:.:|  |.:.|
 Frog    95 SPAKADYTVSVAPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGNIEYSCPASRQ--CEITK 157

  Fly    83 THRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAA 147
            ..|..|::||..||.:|||.|:.|:.:|      :|.....||..|....               
 Frog   158 RRRKSCQSCRFAKCLKVGMLKEGVRLDR------VRGGRQKYKRRMESEN--------------- 201

  Fly   148 LTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYM 212
             :|..|:.:           ||:...|:....|...:.:                    |...| 
 Frog   202 -SGVHGIQI-----------HPSPKKAYTKIVSNLLLAE--------------------PEKIY- 233

  Fly   213 NALATRALP-PTPP---LMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFF 273
                  |:| ||.|   :.....:.:.|...|...:.|.|.:..|:.|.:.||:.||:.:|.|..
 Frog   234 ------AMPDPTVPDSDIKTLTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQGAWMEIL 292

  Fly   274 ILAMAQYLMPMNFAQLLFVYESENANREIMGMVT--REVH-AFQEVLNQLCHLNIDSTEYECLRA 335
            :|.:....:|.   |...||..:....|:...::  |::: ...:::.:...|::|..||..|:|
 Frog   293 LLGVVFRSLPY---QEGLVYAEDYIMDEVQSRMSGLRDLYLCILQLVQRYRKLHMDKEEYVTLKA 354

  Fly   336 ISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTH 400
            ::|   :...|...||:.:                          :..:.:..:.||..:....|
 Frog   355 LAL---ANSDAVHIEDIQS--------------------------IQKLQDVLQEALQEHESSQH 390

  Fly   401 PSQPMRFQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
            ..:|.|...||..:.|:.:.:|..::.....:..|.:.:.:|..:|
 Frog   391 WEEPQRAGQLLLTLPLLRQTASRVVQHFHAIRAQGRVPMHKLFLEM 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 34/94 (36%)
NR_LBD 215..436 CDD:416257 43/227 (19%)
esrrbXP_017951897.2 NR_DBD_ERR 107..201 CDD:143544 38/101 (38%)
NR_LBD_ERR 220..439 CDD:132744 49/276 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.