DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and pgr

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_002935617.1 Gene:pgr / 100493487 XenbaseID:XB-GENE-484457 Length:731 Species:Xenopus tropicalis


Alignment Length:456 Identity:102/456 - (22%)
Similarity:167/456 - (36%) Gaps:98/456 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SEGSPDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQY 68
            |:|.||.            ......|....|.:|.|.:||.|||:..|..|..||||::.....|
 Frog   346 SDGDPDQ------------GGPYETLAQKVCLICGDEASGCHYGVLTCGSCKVFFKRAVEGQHNY 398

  Fly    69 VCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGE 133
            :|..:..  |:|||..|..|.:||||||.:.||.....:.::..|..|.|.     .||::    
 Frog   399 LCAGRND--CIVDKIRRKNCPSCRLRKCCQAGMVLGGRKFKKFGRIKTGRE-----IDALV---- 452

  Fly   134 MPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVH 198
            :|..|...:.....||             :|..:..|....|  .|....:|....|.|.:    
 Frog   453 LPSPPTLFVECQQILT-------------RRISNSSAQEIQF--TPELLQILQSIEPEVVY---- 498

  Fly   199 QGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLL 263
                      |.|.|     ..|.||..:.:. :.:.....|...|.|.||:..|..|.:.||:.
 Frog   499 ----------AGYDN-----TQPETPSALLSS-LNQLCERQLVCVVKWSKSLPGFRNLHIDDQIT 547

  Fly   264 LLEESWKEFFILAMA----QYL--MPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCH 322
            ||:.||....:.||.    |::  ..:.||..|.:.|....:.....:........||.:.    
 Frog   548 LLQYSWMSLMVFAMGWRSYQHVSGQMLYFAPDLILNEQRMKDSSFYTLCLSMWQLPQEFMK---- 608

  Fly   323 LNIDSTEYECLRAISLFRKSP----PSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAA 383
            |.:...|:.|::|:.|....|    .|.:..:|:.::.|         ...|::.||...|.:|:
 Frog   609 LQVTHEEFLCMKALLLLNTIPLEGLKSQTHFDDMRSNYI---------RELAKAIGLRHKGVIAS 664

  Fly   384 MH-----NDARSALHNYIQRTH----------PSQPMRFQTLLGVV--QLMHKVSSFTIEELFFR 431
            ..     .....::|..:::.|          .|..:.|..::..|  ..:.|:.:..::.|.|.
 Frog   665 SQRFYQLTKLMDSMHELVKQLHLYCLNTFLQSRSLSVEFPEMMSEVISAQLPKILAGMVKPLIFH 729

  Fly   432 K 432
            |
 Frog   730 K 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 32/91 (35%)
NR_LBD 215..436 CDD:416257 48/245 (20%)
pgrXP_002935617.1 Prog_receptor <172..361 CDD:366948 5/26 (19%)
NR_DBD_GR_PR 361..437 CDD:143546 30/77 (39%)
NR_LBD_PR 484..731 CDD:132759 54/280 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.