DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nr2f5

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_002938509.1 Gene:nr2f5 / 100491959 XenbaseID:XB-GENE-486334 Length:398 Species:Xenopus tropicalis


Alignment Length:429 Identity:130/429 - (30%)
Similarity:195/429 - (45%) Gaps:118/429 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRK 95
            :|.|.||.|.|||||||.:.|:||..|||||:||:..|.|:..:.  |.:|:.|||||:.|||:|
 Frog    60 NVDCLVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRGNRD--CPIDQHHRNQCQYCRLKK 122

  Fly    96 CFEVGMNKDAVQHER--GPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNT-------AALTGF 151
            |.:|||.::|||..|  .|:.|                      |.:..:|.       :.||||
 Frog   123 CLKVGMRREAVQRGRMSHPQTS----------------------PGQYTLNNVDPYNGHSYLTGF 165

  Fly   152 PGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALA 216
                                             :.|.:...|:            ||:.|    .
 Frog   166 ---------------------------------ISLLLRAEPY------------PTSRY----G 181

  Fly   217 TRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYL 281
            .:.|.|. .:|..|:|.|.||..||..:.|.|::..|.:..:.||:.||..:|.|.|:|..||..
 Frog   182 AQCLQPN-NIMGIENICELAARLLFSAIEWAKNIPFFPDFQLSDQVSLLRMTWSELFVLNAAQCS 245

  Fly   282 MPMNFAQLLF---VYESE-NANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKS 342
            ||::.|.||.   ::.|. :|:|.:..|  ..:..|||.:.:|..|::||.||.||:||:||   
 Frog   246 MPLHVAPLLAAAGLHASPMSADRVVAFM--DHIRVFQEQVEKLKALHVDSAEYSCLKAIALF--- 305

  Fly   343 PPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRF 407
                                      :.::.||.:.|.|.::...::.||..|::..:|:||.||
 Frog   306 --------------------------TPDAVGLSDIGHVESIQEKSQCALEEYVRNQYPNQPTRF 344

  Fly   408 QTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
            ..||..:..:..||:..||:|||.:.:|...|..||.||
 Frog   345 GRLLLRLPSLRIVSAPVIEQLFFVRLVGKTPIETLIRDM 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 45/87 (52%)
NR_LBD 215..436 CDD:416257 68/224 (30%)
nr2f5XP_002938509.1 NR_DBD_COUP_TF 63..135 CDD:143516 40/73 (55%)
NR_LBD_COUP-TF 161..397 CDD:132746 83/304 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.