DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nr1h4

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_002936891.3 Gene:nr1h4 / 100489310 XenbaseID:XB-GENE-487942 Length:478 Species:Xenopus tropicalis


Alignment Length:419 Identity:97/419 - (23%)
Similarity:150/419 - (35%) Gaps:120/419 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKT 83
            |:||.. .|:.....|.||.|::||.||....|:||.|||:|||.::..|.||:  .|.|.:|..
 Frog   118 RVSPRV-GRVKGDELCVVCGDNASGYHYNALTCEGCKGFFRRSITKNAVYKCKN--GGNCEMDMY 179

  Fly    84 HRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAM----MGAGEMPQIPAEILMN 144
            .|.:|:.||||||.::||..:.:..|...::..||:|.....:..    :...|..|:.:....|
 Frog   180 MRRKCQECRLRKCKQMGMLAECLLTEIQCKSKRLRKHAKPQSEKSFQEDIDGHETKQVTSTTKTN 244

  Fly   145 --TAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVP-RVPHHPVHQGHHGFFS 206
              ...||                   ...|...|      .|:|..|. |:|             
 Frog   245 QENTELT-------------------QEQMNLLQ------YVMDSHVKNRLP------------- 271

  Fly   207 PTAAYMNALATRALPPTPPLMAAE----HIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEE 267
                  .:||||.:....  |.::    .:.|.|..|:...|.:.|.:..|..|...||:.||:.
 Frog   272 ------QSLATRLILQED--MGSDDNFVFLTEMATRHVQILVEFTKKLPGFQTLDHEDQIALLKG 328

  Fly   268 SWKEFFILAMAQYLMPMNFAQLLFVYESENANREIMGMVT-------REVHAFQEVLNQLCH--- 322
            |                 ..:.:|:..:|..||:::...|       |:.....:.:|.:.|   
 Frog   329 S-----------------AVEAMFLRSAELFNRKLLERHTDVLEERIRKSGISHDYINPMFHFYK 376

  Fly   323 ----LNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAA 383
                |.:...||..|.|:                   .|||          .:.:.|.:...|..
 Frog   377 SVGELKMVEEEYALLTAV-------------------VILT----------PDRQYLKDKESVEK 412

  Fly   384 MHNDARSALHNYIQRTHPSQPMRFQTLLG 412
            :.......|....:|.||..|..|..|||
 Frog   413 LQETFLHILEKICKRCHPDNPQHFARLLG 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 35/91 (38%)
NR_LBD 215..436 CDD:416257 44/216 (20%)
nr1h4XP_002936891.3 NR_DBD_FXR 129..212 CDD:143520 34/84 (40%)
NR_LBD 252..473 CDD:416257 51/263 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.