DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and esrrgr

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_002938860.2 Gene:esrrgr / 100488364 XenbaseID:XB-GENE-5997544 Length:451 Species:Xenopus tropicalis


Alignment Length:440 Identity:104/440 - (23%)
Similarity:164/440 - (37%) Gaps:125/440 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LYHVP---CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRA 90
            |..||   |.||.|.:||.|||:.:|:.|..||||:|:.:.:|.|.....  |.:.|..|..|:|
 Frog   110 LRSVPKRLCLVCGDTASGYHYGVASCEACKAFFKRTIQGNIEYSCPVVND--CEITKRRRKSCQA 172

  Fly    91 CRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVP 155
            ||.|||..|||.|:.|:.:|                 :.|..:..:.|.|:  :||....:    
 Frog   173 CRFRKCLNVGMMKEGVRLDR-----------------VRGGRQKYRRPVEV--DTADPCSY---- 214

  Fly   156 MPMPGLPQRAGHHP-----------AHMAAFQPPPSAA----AVLDLSVPRVPHHPVHQGHHGFF 205
                    ...||.           :|:...:|....|    :|||                   
 Frog   215 --------ITSHHSVLGKKTMNKVVSHLILVEPGDIFATPDPSVLD------------------- 252

  Fly   206 SPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWK 270
                   |.|.|...           :.|.....|...:.|.|.|..|:.|.:.||:.||:.:|.
 Frog   253 -------NDLRTLTT-----------LCELINRKLLMTIGWAKHVPGFSALSLADQMALLQSAWM 299

  Fly   271 EFFILAMAQYLMPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLC----HLNIDSTEYE 331
            |..:|.:.  ...:..::.|.|.|:....|| ....|..:|.: .||.||.    ...:|..||.
 Frog   300 EILVLGIV--FRSVTLSEELAVAENFLLGRE-QCRSTGLLHLY-NVLLQLVKKYKKTRLDKEEYV 360

  Fly   332 CLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYI 396
            .|:|::              ||||          .|.|.|:   :|:  |.::.:....||.:|.
 Frog   361 TLKAMA--------------LANS----------DSTSIEN---MEA--VLSLQDHLHEALQDYE 396

  Fly   397 QRTHPSQPMRFQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
            :..|.....|...||..:.|:.:.::..:......:..|.|.:.:|..:|
 Frog   397 RENHGEDNHRSGKLLMTLPLLRQTANEAVRTFCQIRLEGRIPMHKLFLEM 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 37/90 (41%)
NR_LBD 215..436 CDD:416257 49/224 (22%)
esrrgrXP_002938860.2 NR_DBD_ERR 112..207 CDD:143544 39/115 (34%)
NR_LBD 230..449 CDD:299703 60/287 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.