DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nr0b1

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_002933661.1 Gene:nr0b1 / 100487043 XenbaseID:XB-GENE-487960 Length:278 Species:Xenopus tropicalis


Alignment Length:235 Identity:52/235 - (22%)
Similarity:99/235 - (42%) Gaps:51/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 ETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLM---------PMNFAQL 289
            :.|:..|.|.:.::|:|..|.|||:.||:||:...|....:|.:||..:         |....::
 Frog    68 KAASAVLVKTLRFVKNVPCFQELPLDDQMLLVRSCWAPLLVLGLAQDKVDFETVETSEPSMLQRI 132

  Fly   290 LFVYE----SENANREIMGM---------VTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRK 341
            |...:    .::....::|.         ...|:...:|.|::..:|:|.:.||..|:.|.||..
 Frog   133 LTTRQDGEKKQSQQDSLLGSPQHKLSQLPSAAEIRWIKEFLDKCWNLDISTKEYAYLKGIVLFNP 197

  Fly   342 SPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMR 406
            ..|                             ||.....:..:.::|:.||:.:::..|..:..|
 Frog   198 ELP-----------------------------GLHCIQYIQGLQHEAQQALNEHVKMIHRWEQTR 233

  Fly   407 FQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
            |..|:.|:..:..|::..|.|||||..||.:.:..::.:|
 Frog   234 FTKLIIVLSFLRTVNANAIAELFFRPIIGSVNMDDMLLEM 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537
NR_LBD 215..436 CDD:416257 50/223 (22%)
nr0b1XP_002933661.1 NR_Repeat 9..58 CDD:372889
NR_LBD_Dax1 43..272 CDD:132764 51/232 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.