DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and asb15

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_002941876.2 Gene:asb15 / 100486500 XenbaseID:XB-GENE-1014023 Length:586 Species:Xenopus tropicalis


Alignment Length:175 Identity:31/175 - (17%)
Similarity:57/175 - (32%) Gaps:52/175 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGH--------HPAHMA 173
            ::|..||::.|..|..::..:..:...|.:...||...|:   |:....||        |.....
 Frog   172 VKRWSAMHEAAKQGRRDLVSLLLKNGGNVSLEDGFGVTPL---GVAAEYGHCDILEQLIHKGGDV 233

  Fly   174 AFQPPPSAAAVLDLSVPRVP--------------------HHPVHQGHHG-------FFSPTAAY 211
            .||....::.:.|.:....|                    :.|:|:..:|       :..| |..
 Frog   234 NFQAHDGSSVLSDAATGGDPDCIALLLEYGASGNIPDKEGYLPIHKAAYGGHYLALKYLIP-ATS 297

  Fly   212 MNALATRALPPTPPLMAAEH-------------IKETAAEHLFKN 243
            .||:....|.|.......::             :.|..|||:.:|
 Frog   298 KNAIKRSGLSPVHSATDGQNLQCLELLIENDFDVNEVLAEHVSEN 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 31/175 (18%)
NR_LBD 215..436 CDD:416257 7/42 (17%)
asb15XP_002941876.2 PHA02875 47..>268 CDD:165206 17/98 (17%)
ANK repeat 73..105 CDD:293786
ANK repeat 107..138 CDD:293786
ANK repeat 140..171 CDD:293786
ANK repeat 175..204 CDD:293786 5/28 (18%)
ANK repeat 206..237 CDD:293786 7/33 (21%)
PHA02875 214..>446 CDD:165206 21/130 (16%)
ANK repeat 239..270 CDD:293786 2/30 (7%)
ANK repeat 343..374 CDD:293786 31/175 (18%)
ANK repeat 378..408 CDD:293786
ANK repeat 410..442 CDD:293786
SOCS 529..584 CDD:413360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.