powered by:
Protein Alignment tll and banf1
DIOPT Version :9
Sequence 1: | NP_524596.1 |
Gene: | tll / 43656 |
FlyBaseID: | FBgn0003720 |
Length: | 452 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002940546.1 |
Gene: | banf1 / 100380105 |
XenbaseID: | XB-GENE-5745250 |
Length: | 90 |
Species: | Xenopus tropicalis |
Alignment Length: | 37 |
Identity: | 11/37 - (29%) |
Similarity: | 17/37 - (45%) |
Gaps: | 3/37 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 238 EHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFI 274
|.||| :|:|...:.......|....|:| |.:.|:
Frog 57 EELFK--DWLKDTCSANAKQSRDCFGCLKE-WCDAFL 90
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tll | NP_524596.1 |
NR_DBD_TLX |
25..117 |
CDD:143537 |
|
NR_LBD |
215..436 |
CDD:416257 |
11/37 (30%) |
banf1 | XP_002940546.1 |
BAF |
2..87 |
CDD:367274 |
10/32 (31%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.