DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Nr2e3

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_038938356.1 Gene:Nr2e3 / 100365683 RGDID:2318602 Length:395 Species:Rattus norvegicus


Alignment Length:427 Identity:146/427 - (34%)
Similarity:214/427 - (50%) Gaps:86/427 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |:||.|.|||||||||||:||:||||||:||...|.|: ...|:|.|||.|||||:||||:||.:
  Rat    40 CRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQ-VGAGMCPVDKAHRNQCQACRLKKCLQ 103

  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQ 163
            .|||:||||:||.||:      :|......|..|..|:                  |.|:...|.
  Rat   104 AGMNQDAVQNERQPRS------LAQVHLESMEPGSDPR------------------PEPVVASPA 144

  Fly   164 RAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFS-----------PTAAYMNALAT 217
            .||..|      :.|.|.:|...:            |||...|           |..|..|...|
  Rat   145 LAGPSP------RGPTSVSAARAM------------GHHFMASLISAETCAKLEPEDAEENIDVT 191

  Fly   218 RALP--PTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQY 280
            ...|  |..| ...:.|.||:|..||..|.|.|::..|:.||..||::||||:|.|.|:|...|:
  Rat   192 SNDPEFPASP-CNLDGIHETSARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWNELFLLGAIQW 255

  Fly   281 LMPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPS 345
            .:|::...||...|:.::::..:.:.:.|:...||.:::...|.:|.||:.||:|:.||:     
  Rat   256 SLPLDSCPLLAPPEASSSSQGRLALASAEMRFLQETISRFRALAVDPTEFACLKALVLFK----- 315

  Fly   346 ASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTL 410
                                    .|:|||.:...|.|:.:.::..|..:.:..|||||:||..|
  Rat   316 ------------------------PETRGLKDPDHVEALQDQSQVMLSQHSKAHHPSQPVRFGKL 356

  Fly   411 LGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDMY 447
            |.::..:..:::..||.||||||||:..:.:|:.||:
  Rat   357 LLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMF 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 54/82 (66%)
NR_LBD 215..436 CDD:416257 68/222 (31%)
Nr2e3XP_038938356.1 NR_DBD_PNR 32..123 CDD:143528 55/89 (62%)
NR_LBD_Tlx_PNR_like 185..382 CDD:132748 69/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D373206at33208
OrthoFinder 1 1.000 - - FOG0001683
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X118
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.