DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and atxn7

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_012815985.1 Gene:atxn7 / 100127691 XenbaseID:XB-GENE-956283 Length:905 Species:Xenopus tropicalis


Alignment Length:308 Identity:73/308 - (23%)
Similarity:106/308 - (34%) Gaps:89/308 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PGVPMPMP---GLPQRAGHHPAHMAAFQPPPSAAAVLD---------------LSVPRVPHHPVH 198
            |.:|..:|   |.|....|...|......|..||..:.               .:..|.......
 Frog    21 PRLPYKLPPVSGGPAPPAHSRTHSPRQASPGPAAERMSERAEDDVTGEQQQRRAAAGRQQRRQQQ 85

  Fly   199 QGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLL 263
            ||.    |.:||.|.|...|...|:|..|..:           ...:|:::|:.       ..|.
 Frog    86 QGE----SSSAAAMAAGGDRTSLPSPGAMLGQ-----------PWAHWVEAVKL-------HGLE 128

  Fly   264 LLEESWKEFFILAMAQYLMPMNFAQLLFVYESENANRE---IMGMVTREVHAFQEVLNQLC-HLN 324
            .|||||||.....                 ||...:||   |.|:..    |:.|....:| |.|
 Frog   129 ELEESWKECDKKR-----------------ESMRLSREDMAIFGLCP----AYDEFYLVMCSHCN 172

  Fly   325 ------IDSTEYECLRAISLFRKSP--PSASSTEDL----ANSSILTGSGS-----PNSSASAES 372
                  ...:.||  |..|...|:|  |.:|||..|    ::.:..:|.||     |:|.:||.|
 Frog   173 QVIKPQAFQSHYE--RRHSSINKTPVTPPSSSTNSLYSTVSSKTKPSGGGSCSSTRPSSGSSASS 235

  Fly   373 RG-LLESGKVAAMHNDARSALHNYIQRTHPSQPM-RFQTLLGVVQLMH 418
            .. |::|.|.......:..::|. :|  |...|. :..|....|:.||
 Frog   236 NSKLMKSPKDKLPIGGSNKSVHP-VQ--HSKAPQEKIMTPSVKVEKMH 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537
NR_LBD 215..436 CDD:416257 55/227 (24%)
atxn7XP_012815985.1 SCA7 347..412 CDD:369807
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.