DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nr1d1

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001093675.1 Gene:nr1d1 / 100101679 XenbaseID:XB-GENE-478094 Length:522 Species:Xenopus tropicalis


Alignment Length:478 Identity:125/478 - (26%)
Similarity:190/478 - (39%) Gaps:122/478 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLSPAASSRILYHVP-----CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLC 78
            |:||:.:|..:..:.     ||||.|.:||.|||::||:||.|||:|||:::.||. |..|...|
 Frog    95 RVSPSKTSSSITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYK-KCLKNETC 158

  Fly    79 VVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLR----RHMAMYKDAMMGAGEMPQIP- 138
            .:.:.:||:|:.||.|||..|||::|||:..|.|:....|    .|.||...|....|....|| 
 Frog   159 SIVRINRNRCQQCRFRKCLSVGMSRDAVRFGRIPKREKQRMLAEMHSAMNHIASGHFGRRSPIPL 223

  Fly   139 -------------AEILMNTAALTGFPGVPMPMP-GLPQRAGHHPAHMAAFQPP--PSAAAVLD- 186
                         :..||.||        |...| .||.....:|..:.   ||  ||...:.| 
 Frog   224 QPHQQQQQQLHPSSSPLMGTA--------PCHSPTSLPDAYSQYPQQLT---PPRSPSPEHMDDV 277

  Fly   187 LSVPRVPH-------------------------HPVHQGHHGFFSPTAAYMNALATRALPPTPPL 226
            :|...:.|                         |.....|.......|..||||....     |:
 Frog   278 ISQVSMAHRQIFVYANDKVNKKTSWDHPQPCWSHDTEDSHGNHNIRLACPMNALHRGG-----PV 337

  Fly   227 MAAEHIKE------TAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMN 285
            .:.:.:.|      |.|  :.:.|.:.:.:..|.:|...||:.||:....|         ::.:.
 Frog   338 RSVQEVWEDFSLSFTPA--VREVVEFARHIPGFKDLTQNDQVTLLKAGTFE---------VLMVR 391

  Fly   286 FAQLLFVYESENANREIMGMV--TREVHA--FQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSA 346
            ||.|...  .|::.|.:.|..  ..|:||  ..|:|:.:...:      |.|.::||        
 Frog   392 FASLFDA--REHSLRFLSGATYSLPELHAMGMGELLSSMFDFS------EKLSSLSL-------- 440

  Fly   347 SSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTL- 410
             |.|:|...:.|.       ..||:..|:..|..|..:......||.:.|.:..|:...||..| 
 Frog   441 -SQEELGIFTALV-------LVSADRSGMENSSLVEQLQETLIRALRSLILKNSPNDTSRFTKLL 497

  Fly   411 -----LGVVQLMH--KVSSFTIE 426
                 |..:..||  |:.||.::
 Frog   498 LRLPDLRTLNNMHSEKLLSFRVD 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 42/96 (44%)
NR_LBD 215..436 CDD:416257 50/230 (22%)
nr1d1NP_001093675.1 NR_DBD_REV_ERB 110..198 CDD:143540 41/88 (47%)
NR_LBD 331..519 CDD:299703 50/227 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.