DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and ar

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001076592.1 Gene:ar / 100005148 ZFINID:ZDB-GENE-060131-1 Length:868 Species:Danio rerio


Alignment Length:429 Identity:101/429 - (23%)
Similarity:160/429 - (37%) Gaps:107/429 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.:|.|.:||.|||...|..|..||||:....::|:|.|:..  |.:||..|..|.:|||:||||
Zfish   512 CLICSDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRND--CTIDKLRRKNCPSCRLKKCFE 574

  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQ 163
            |||...|         ..||:...|.....:||.:.|....:.|             .|.|.|  
Zfish   575 VGMTLGA---------RKLRKIGQMKGPDEVGAVQGPSETVQCL-------------SPKPNL-- 615

  Fly   164 RAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGH-HGFFSPTAAYMNALATRALPPTPPLM 227
                      .|........:|:...|.|    |:.|| ||.....||.:.:|            
Zfish   616 ----------TFHSQLIFLNILEAIEPEV----VNAGHDHGQPDSAAALLTSL------------ 654

  Fly   228 AAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFV 292
                 .|.....|.|.|.|.|.:..|..|.:.||:.:::.:|....:.|:.........|::|:.
Zfish   655 -----NELGERQLVKVVKWAKGLPGFRNLHVDDQMTVIQHTWMGVMVFALGWRSYKNANARMLYF 714

  Fly   293 YESENANREIMGMVTREVHAFQ--EVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANS 355
            ......|...|.:.:...|..|  .:..:...|.:...|:.|::|:.||...|.....::...:.
Zfish   715 APDLVFNDRRMHVSSMYEHCVQMKHLSQEFVLLQVTQEEFLCMKALLLFSVIPVEGLKSQKYFDE 779

  Fly   356 SILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQ-------TLLGV 413
            ..||                         :.:....|.||.::|:.:  ||||       :|..|
Zfish   780 LRLT-------------------------YINELDRLINYGRKTNCA--MRFQQLTRLMDSLQPV 817

  Fly   414 VQLMHKVSSFTIE----------ELFFRKTIGDITIVRL 442
            ||.:|:   ||.:          ::.|.:.|.:|..|::
Zfish   818 VQKLHQ---FTFDLFVQARSLPTKVSFPEMIAEIISVQV 853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 33/82 (40%)
NR_LBD 215..436 CDD:416257 45/239 (19%)
arNP_001076592.1 NR_DBD_AR 507..588 CDD:143547 35/86 (41%)
NR_LBD 622..867 CDD:299703 57/283 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.