DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nr0b1

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001076416.1 Gene:nr0b1 / 100001692 ZFINID:ZDB-GENE-070130-1 Length:264 Species:Danio rerio


Alignment Length:224 Identity:51/224 - (22%)
Similarity:92/224 - (41%) Gaps:39/224 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 ETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLM---------PMNFAQL 289
            :.|:..|.|.:.::|:|..|.|||..||..|:...|....:|.|||..:         |....::
Zfish    67 KAASAVLVKTLKFVKNVPCFRELPADDQHTLVRSGWAPLLVLGMAQDRIDFETSETQEPSMLQRI 131

  Fly   290 LFVYESENANREIMGMVT-REVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLA 353
            |...:.:..|:...|.|. .:|...:..|.:...|:|.:.||..|:...||         ..|:|
Zfish   132 LTSGQDKQDNQSHNGGVALTDVQGIKMFLRKCWGLDISTKEYAYLKGAILF---------NPDVA 187

  Fly   354 NSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTLLGVVQLMH 418
                                ||.....:.|:.::|..||:.|::..|.....||..|...:.::.
Zfish   188 --------------------GLQCQHYIQALQSEANQALNEYVKMIHRGDSARFAKLFLALSMLR 232

  Fly   419 KVSSFTIEELFFRKTIGDITIVRLISDMY 447
            .:::..:..|||:..||.:.:..|:.:|:
Zfish   233 SINANVVAGLFFKPVIGAVNMEELLLEMF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537
NR_LBD 215..436 CDD:416257 48/211 (23%)
nr0b1NP_001076416.1 NR_Repeat 15..57 CDD:290753
NR_LBD_Dax1 44..259 CDD:132764 50/220 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.