DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cindr and Nost

DIOPT Version :9

Sequence 1:	NP_001263129.1	Gene:	cindr / 43654	FlyBaseID:	FBgn0027598	Length:	941	Species:	Drosophila melanogaster
Sequence 2:	NP_001285029.1	Gene:	Nost / 8673992	FlyBaseID:	FBgn0259734	Length:	1330	Species:	Drosophila melanogaster

Alignment Length:	52	Identity:	25/52 - (48%)
Similarity:	37/52 - (71%)	Gaps:	0/52 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    97 RCKVIYSYTQVNDDELTLAVGDVIEFLGEVEEGWWRGRLRSKVGVFPSNFVQ 148
            |||.:||||....|||.|:.||:||...:.::|||.|.||:.:|:||:.:|:
  Fly  1276 RCKALYSYTPKLYDELELSPGDIIEVHAKQDDGWWLGALRNHIGIFPATYVE 1327

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cindr	NP_001263129.1	SH3_CD2AP-like_1	6..60	CDD:212806
		SH3_CD2AP-like_2	97..149	CDD:212807	25/52 (48%)
		SH3_CD2AP-like_3	258..310	CDD:212808
Nost	NP_001285029.1	F-BAR_NOSTRIN	663..908	CDD:153342
Nost	NP_001285029.1	SH3_Nostrin	1276..1328	CDD:212757	25/52 (48%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	41	1.000	Domainoid score	I3230
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1577081at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR14167
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	3	3.110