DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cindr and AT4G18060

DIOPT Version :9

Sequence 1:NP_001263129.1 Gene:cindr / 43654 FlyBaseID:FBgn0027598 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_193540.3 Gene:AT4G18060 / 827531 AraportID:AT4G18060 Length:351 Species:Arabidopsis thaliana


Alignment Length:335 Identity:73/335 - (21%)
Similarity:124/335 - (37%) Gaps:81/335 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DELDLQKGAIIHRIKQMPGGWWQGTLKASGVTGMFPDNFVRVLESGVSSNGNGTTGSGDHIEVGT 83
            |||::|:.   |::.::    ::.|..|.    .|..:.|:..|:       .||....|||.||
plant    40 DELEMQRH---HQLDKL----YRSTRSAK----EFQRDIVKAAEA-------FTTIGLRHIEAGT 86

  Fly    84 AVQLRDKSATSNRRCKVIYSYTQVNDDELTLA-----VGDVIEFLGEVEEGWWR-------GRLR 136
            .:        |...|:.....:| |.||..||     .||..:.:.:.:|.:.:       ..||
plant    87 KL--------SEDCCRYGNENSQ-NIDENILAKAAAIYGDARKHVDKEQEDFNKLLASQVLDPLR 142

  Fly   137 SKVGVFPSNFVQHIEPSPVLASKRPPTIGATVTTSALTSKAANVANVAATATVPTGGA-VPPAST 200
            :.|...|....:|:       ::|...:.....|.| |..:...|.| ..|.:|...| :..|..
plant   143 AMVAGSPLEDARHL-------AQRYSRMRQEAETHA-TEVSRRQARV-REAPIPENVAKLQLAEA 198

  Fly   201 SISTSTTKQATKSRATAAAAASAPAEP----------------------AAIVSGSGA---AAGG 240
            .:.......|...:...||.|:..::.                      |||:|...|   ....
plant   199 KMQELKANMAVLGKEATAALAAVESQQHRLTFQRLVAMVEGEKNYHLRIAAILSDIEAEMVTEKQ 263

  Fly   241 GAAAAVPMLPPKPQRE-----FCRVEFPYAPQNDDELELKVDDIIAVISTELPDKGWWKGEIRGK 300
            ...:|.|.:|.:...|     ...|..|::..::.||:|...|.|.|  .::...||.:||.:||
plant   264 HKESAPPAIPTENGSEKTSYFLAEVIHPFSAASEKELDLDKGDYIVV--RKVSQTGWAEGECKGK 326

  Fly   301 VGVFPDNFVK 310
            .|.||..:::
plant   327 AGWFPMAYIE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cindrNP_001263129.1 SH3_CD2AP-like_1 6..60 CDD:212806 9/40 (23%)
SH3_CD2AP-like_2 97..149 CDD:212807 14/63 (22%)
SH3_CD2AP-like_3 258..310 CDD:212808 17/51 (33%)
AT4G18060NP_193540.3 BAR 49..257 CDD:416402 46/240 (19%)
SH3 285..337 CDD:418401 17/54 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.