powered by:
Protein Alignment cindr and EndoA
DIOPT Version :9
Sequence 1: | NP_001263129.1 |
Gene: | cindr / 43654 |
FlyBaseID: | FBgn0027598 |
Length: | 941 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262717.1 |
Gene: | EndoA / 42265 |
FlyBaseID: | FBgn0038659 |
Length: | 369 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 21/72 - (29%) |
Similarity: | 42/72 - (58%) |
Gaps: | 2/72 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 243 AAAVPMLPPKPQREFCRVEFPYAPQNDDELELKVDDIIAVISTELPDKGWWKGEIRGKVGVFPDN 307
|.::.:.|.:.|:..|:..:.:.|:|..||..|.:|||.:::. .|..|::|.:.|:.|.||.:
Fly 295 AKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNR--VDDNWFEGAVNGRTGYFPQS 357
Fly 308 FVKMLAP 314
:|::..|
Fly 358 YVQVQVP 364
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR14167 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.