DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cindr and EndoA

DIOPT Version :9

Sequence 1:NP_001263129.1 Gene:cindr / 43654 FlyBaseID:FBgn0027598 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster


Alignment Length:72 Identity:21/72 - (29%)
Similarity:42/72 - (58%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 AAAVPMLPPKPQREFCRVEFPYAPQNDDELELKVDDIIAVISTELPDKGWWKGEIRGKVGVFPDN 307
            |.::.:.|.:.|:..|:..:.:.|:|..||..|.:|||.:::.  .|..|::|.:.|:.|.||.:
  Fly   295 AKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNR--VDDNWFEGAVNGRTGYFPQS 357

  Fly   308 FVKMLAP 314
            :|::..|
  Fly   358 YVQVQVP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cindrNP_001263129.1 SH3_CD2AP-like_1 6..60 CDD:212806
SH3_CD2AP-like_2 97..149 CDD:212807
SH3_CD2AP-like_3 258..310 CDD:212808 16/51 (31%)
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276
SH3_Endophilin_A 312..361 CDD:212737 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.