DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cindr and EndoA

DIOPT Version :10

Sequence 1:NP_001263129.1 Gene:cindr / 43654 FlyBaseID:FBgn0027598 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_620122.2 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster


Alignment Length:72 Identity:21/72 - (29%)
Similarity:42/72 - (58%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 AAAVPMLPPKPQREFCRVEFPYAPQNDDELELKVDDIIAVISTELPDKGWWKGEIRGKVGVFPDN 307
            |.::.:.|.:.|:..|:..:.:.|:|..||..|.:|||.:::.  .|..|::|.:.|:.|.||.:
  Fly   295 AKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNR--VDDNWFEGAVNGRTGYFPQS 357

  Fly   308 FVKMLAP 314
            :|::..|
  Fly   358 YVQVQVP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cindrNP_001263129.1 SH3_CD2AP-like_1 6..60 CDD:212806
SH3_CD2AP-like_2 97..149 CDD:212807
SH3_CD2AP-like_3 258..310 CDD:212808 16/51 (31%)
EndoANP_620122.2 BAR_Endophilin_A 25..246 CDD:153276
SH3_Endophilin_A 312..361 CDD:212737 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.