DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cindr and Abi

DIOPT Version :10

Sequence 1:NP_001263129.1 Gene:cindr / 43654 FlyBaseID:FBgn0027598 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_001247091.1 Gene:Abi / 41718 FlyBaseID:FBgn0020510 Length:477 Species:Drosophila melanogaster


Alignment Length:34 Identity:8/34 - (23%)
Similarity:20/34 - (58%) Gaps:3/34 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FNYCFVS--PTYLHF-DSLCNRYEFQHKNVFRNV 40
            |.|..:.  |.||.. :::..:|:.:.|::|:::
  Fly   219 FQYALMKQWPLYLSTKNTILKKYDGRFKDIFQDI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cindrNP_001263129.1 SH3_CD2AP-like_1 6..60 CDD:212806 8/34 (24%)
SH3_CD2AP-like_2 97..149 CDD:212807
SH3_CD2AP-like_3 258..310 CDD:212808
AbiNP_001247091.1 Abi_HHR 105..168 CDD:462279
SH3_Abi 423..474 CDD:212760
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.