DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cindr and Lasp

DIOPT Version :10

Sequence 1:NP_001263129.1 Gene:cindr / 43654 FlyBaseID:FBgn0027598 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_730192.2 Gene:Lasp / 39864 FlyBaseID:FBgn0063485 Length:657 Species:Drosophila melanogaster


Alignment Length:48 Identity:17/48 - (35%)
Similarity:31/48 - (64%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YEYAAKEPDELDLQKGAIIHRIKQMPGGWWQGTLKASGVTGMFPDNFV 58
            |:|.|::.||:..::|.:|..::.:..||..|.::.:|.|||.|.|:|
  Fly   605 YDYEAQDVDEVSFREGDVIFEVESIDSGWMTGRVERTGKTGMLPANYV 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cindrNP_001263129.1 SH3_CD2AP-like_1 6..60 CDD:212806 17/48 (35%)
SH3_CD2AP-like_2 97..149 CDD:212807
SH3_CD2AP-like_3 258..310 CDD:212808
LaspNP_730192.2 LIM_LASP 5..57 CDD:188831
Nebulin 67..94 CDD:459977
NEBU 97..127 CDD:128523
SH3_Nebulin_family_C 600..654 CDD:212723 17/48 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.