DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cindr and CAP

DIOPT Version :9

Sequence 1:NP_001263129.1 Gene:cindr / 43654 FlyBaseID:FBgn0027598 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_001369075.1 Gene:CAP / 36084 FlyBaseID:FBgn0033504 Length:2568 Species:Drosophila melanogaster


Alignment Length:319 Identity:72/319 - (22%)
Similarity:125/319 - (39%) Gaps:91/319 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YEYAAKEPDELDLQKGAIIHRIKQMPGGWWQGTLKASGVTGMFPDNFVRVLESGVSSNGNGTTGS 75
            :.:..:...||..:||..|:..:|:...|::|  :.:.:.|:.|.::|.::.             
  Fly  2320 FNFQGQTSKELSFRKGDTIYIRRQIDANWYEG--EHNAMIGLLPASYVEIVS------------- 2369

  Fly    76 GDHIEVGTAVQLRDKSATSNRR-----CKVIYSYTQVNDDELTLAVGDVIEFLGEVEEGWWRGRL 135
                        ||.:.|.::|     .:..|::...:..||:|..|:::.....|:..|:.|::
  Fly  2370 ------------RDGARTPSKRPSEGQARAKYNFQAQSGIELSLNKGELVTLTRRVDGNWFEGKI 2422

  Fly   136 RSKVGVFPSNFVQHIEPSPVLASKRPPTIGATVTTSALTSKA------------ANVANVAATAT 188
            .::.|:||.::|:      ||.......|.|. ||:.:||::            .|:.|...|.|
  Fly  2423 ANRKGIFPCSYVE------VLTDIGAEDIAAR-TTTVITSQSTTNLRPNLDVLRTNINNEFNTLT 2480

  Fly   189 VPTGGAVPPASTSISTSTTKQATKSRATAAAAASAPAEPAAIVSGSGAAAGGGAAAAVPMLPPKP 253
              ..||.||      ....|:......|.|......:||.|.                       
  Fly  2481 --QNGAQPP------NGILKETRTLHKTDALHVDTSSEPLAY----------------------- 2514

  Fly   254 QREFCRVEFPYAPQNDDELELKVDDIIAVISTELPDKGWWKG--EIRGKVGVFPDNFVK 310
                 |..:.|.|||.|||||...|::.|:  |..|.||:.|  :..|..|.||.|:|:
  Fly  2515 -----RALYKYRPQNSDELELLEGDVVHVL--EKCDDGWFVGTSQRTGCFGTFPGNYVE 2566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cindrNP_001263129.1 SH3_CD2AP-like_1 6..60 CDD:212806 11/48 (23%)
SH3_CD2AP-like_2 97..149 CDD:212807 13/56 (23%)
SH3_CD2AP-like_3 258..310 CDD:212808 22/53 (42%)
CAPNP_001369075.1 MDN1 <43..328 CDD:227596
Sorb 1959..2003 CDD:413404
SH3_Sorbs_1 2315..2367 CDD:212715 11/48 (23%)
SH3_Sorbs_2 2384..2436 CDD:212716 12/57 (21%)
SH3_Sorbs_3 2514..2567 CDD:212714 23/83 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I3230
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14167
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.