DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dj-1beta and DJ1F

DIOPT Version :9

Sequence 1:NP_651825.4 Gene:dj-1beta / 43652 FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_191023.1 Gene:DJ1F / 824625 AraportID:AT3G54600 Length:399 Species:Arabidopsis thaliana


Alignment Length:210 Identity:47/210 - (22%)
Similarity:82/210 - (39%) Gaps:54/210 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KSALVILAPGAEEMEFIIAADVLRRAGIK---VTVAGLNGGEAVKCSRDV-------QILPD--- 54
            ||.|::.....|..|.|:...||:..|:.   |:.....|.:.|..:.|:       :::.|   
plant     7 KSVLMLCGEFMEAYETIVPLYVLQAFGVSVHCVSPGRKTGDKCVMAAHDLLGLEIYTELVVDHLT 71

  Fly    55 --TSLAQVASDKFDVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAI----------CAAP 107
              .:...|..|::|.:::|||           ...:||.:.|....|:|..          |.:.
plant    72 LNANFDGVIPDQYDAIIIPGG-----------RFTELLSADEKCVSLVARFAELKKLIFTSCHSQ 125

  Fly   108 TVLAKHG-VASGKSLTSYPSMKPQL------------VNNYSYVDDKTVVKDGNLITSRG-PGTA 158
            ..||..| :..|...|::.||||.:            |.....:.|  .||||:.:::.| |...
plant   126 LFLAAAGLLTGGMKCTAFESMKPFIELSGGAWWQQPGVQTLFEITD--CVKDGSFMSTMGWPTLG 188

  Fly   159 YEFALKIAEELAGKE 173
            :  :||:..|..|.:
plant   189 H--SLKVLLESLGSK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 46/209 (22%)
DJ1FNP_191023.1 GATase1_PfpI_1 8..198 CDD:153243 45/204 (22%)
GATase1_PfpI_1 212..393 CDD:153243
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.