DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dj-1beta and DJ1A

DIOPT Version :9

Sequence 1:NP_651825.4 Gene:dj-1beta / 43652 FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_188117.1 Gene:DJ1A / 820728 AraportID:AT3G14990 Length:392 Species:Arabidopsis thaliana


Alignment Length:187 Identity:69/187 - (36%)
Similarity:104/187 - (55%) Gaps:1/187 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKSALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFD 66
            :|:.|:.:|.|.|.:|.:....||||.|..||||.:.....|.....::::.||.|:.:....||
plant     5 TKTVLIPIAHGTEPLEAVAMITVLRRGGADVTVASVETQVGVDACHGIKMVADTLLSDITDSVFD 69

  Fly    67 VVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTV-LAKHGVASGKSLTSYPSMKPQ 130
            ::||||||.|...:.....:.::::.|:|.|.|.||||.||.: |...|:..||..|.||....:
plant    70 LIVLPGGLPGGETLKNCKSLENMVKKQDSDGRLNAAICCAPALALGTWGLLEGKKATGYPVFMEK 134

  Fly   131 LVNNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLVAYN 187
            |....:...:..|..||.::|||||||..||::.:.|:|.||||..||:..||:..|
plant   135 LAATCATAVESRVQIDGRIVTSRGPGTTIEFSITLIEQLFGKEKADEVSSILLLRPN 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 65/177 (37%)
DJ1ANP_188117.1 not_thiJ 7..185 CDD:213612 65/177 (37%)
GATase1_DJ-1 231..377 CDD:153229
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 125 1.000 Domainoid score I1789
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38295
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - mtm1166
orthoMCL 1 0.900 - - OOG6_101257
Panther 1 1.100 - - O PTHR48094
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.