Sequence 1: | NP_651825.4 | Gene: | dj-1beta / 43652 | FlyBaseID: | FBgn0039802 | Length: | 187 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_850303.1 | Gene: | YLS5 / 818470 | AraportID: | AT2G38860 | Length: | 398 | Species: | Arabidopsis thaliana |
Alignment Length: | 206 | Identity: | 53/206 - (25%) |
---|---|---|---|
Similarity: | 81/206 - (39%) | Gaps: | 31/206 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSKSALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLN---GGEAVKCSRDV------------Q 50
Fly 51 ILPDTSLAQVASDKFDVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGV 115
Fly 116 -ASGKSLTSYPSMKP----------QLVNNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEEL 169
Fly 170 AGK----EKVQ 176 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dj-1beta | NP_651825.4 | not_thiJ | 4..181 | CDD:213612 | 52/203 (26%) |
YLS5 | NP_850303.1 | GATase1_PfpI_1 | 10..198 | CDD:153243 | 44/188 (23%) |
GATase1_PfpI_1 | 211..392 | CDD:153243 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |