DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dj-1beta and park7

DIOPT Version :9

Sequence 1:NP_651825.4 Gene:dj-1beta / 43652 FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001015851.1 Gene:park7 / 548568 XenbaseID:XB-GENE-1005316 Length:189 Species:Xenopus tropicalis


Alignment Length:185 Identity:103/185 - (55%)
Similarity:134/185 - (72%) Gaps:4/185 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KSALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASD-KFD 66
            |.||:|||.||||||.:|.|||:||||||||:|||:|.:.|.|||||.:.|||||.:..:. .:|
 Frog     4 KRALLILAKGAEEMETVIPADVMRRAGIKVTIAGLSGKDPVLCSRDVVLCPDTSLEEARTQGPYD 68

  Fly    67 VVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQL 131
            |||||||..|:..:.||.:|.::|:.||:..||||||||.||.|..|||..||::|::|..|.::
 Frog    69 VVVLPGGNLGAQNLSESPVVKEVLKEQEAKNGLIAAICAGPTALTVHGVGIGKTITTHPLAKDKI 133

  Fly   132 VN--NYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLV 184
            ||  :|.|.::: ||||||.||||||||::||||.|...|.|||...:|...||:
 Frog   134 VNADHYKYSEER-VVKDGNFITSRGPGTSFEFALMIVSTLVGKEVADQVKSPLLL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 100/179 (56%)
park7NP_001015851.1 GAT_1 5..184 CDD:412116 100/179 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3325
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38295
Inparanoid 1 1.050 198 1.000 Inparanoid score I3681
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1165707at2759
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - otm49379
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1763
SonicParanoid 1 1.000 - - X2164
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.