DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dj-1beta and GATD1

DIOPT Version :9

Sequence 1:NP_651825.4 Gene:dj-1beta / 43652 FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_024304258.1 Gene:GATD1 / 347862 HGNCID:26616 Length:229 Species:Homo sapiens


Alignment Length:170 Identity:34/170 - (20%)
Similarity:61/170 - (35%) Gaps:52/170 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKSA--LVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVAS- 62
            |:.:|  |.:..||.:.|||:   ||..              ...:..:|.::....|.|::.| 
Human    34 MASTAFNLQVATPGGKAMEFV---DVTE--------------SNARWVQDFRLKAYASPAKLESI 81

  Fly    63 --DKFDVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYP 125
              .::..:::|...|....:..|..:..:|:...|....|.|:        .||||:....|:  
Human    82 DGARYHALLIPSCPGALTDLASSGSLARILQHFHSESKPICAV--------GHGVAALCCATN-- 136

  Fly   126 SMKPQLVNNYSYVDDKTVVKDGNLITS-------RGPGTA 158
                         :|::.|.|...:|.       |.||.|
Human   137 -------------EDRSWVFDSYSLTGPSVCELVRAPGFA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 33/167 (20%)
GATD1XP_024304258.1 GAT_1 12..184 CDD:320716 34/170 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.