DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dj-1beta and Gatd1

DIOPT Version :9

Sequence 1:NP_651825.4 Gene:dj-1beta / 43652 FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_742114.3 Gene:Gatd1 / 213350 MGIID:2387178 Length:220 Species:Mus musculus


Alignment Length:197 Identity:46/197 - (23%)
Similarity:80/197 - (40%) Gaps:49/197 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKSALVILAPGAEE---MEFIIAADVLRRAGIKVTVAGLNGGEAV----------KCSRDVQILP 53
            |:.|.:::|.||.|   .:..:....|..|...:.|| ..||:|:          :..:|.::..
Mouse     8 SRPACLLVASGASEGVSAQSFVHCFTLASAAFNLQVA-TPGGKAIDFVDVTESNARWVQDFRLKA 71

  Fly    54 DTSLAQVAS---DKFDVVVLPGGLGGSNAMGESSLVGDLL---RSQES-----GGGLIAAICAAP 107
            ..|.|::.|   .::..:::|...|....:..|..:..:|   ||:..     |.| :||:|.| 
Mouse    72 YASPAKLESIDGARYHALLIPSCPGALTDLASSGSLARILQHFRSESKPICAIGHG-VAALCCA- 134

  Fly   108 TVLAKHGVASGKSLTSYPSM-----------KPQLVNNY----------SYVDDKTVVKDGNLIT 151
            |...:..|..|.|||. ||:           .|.:|.::          |..|...||.|.:|:|
Mouse   135 TNEDRSWVFQGYSLTG-PSVYELIRAPGFARLPLIVEDFVKDSGAGFSASEPDAVHVVLDRHLVT 198

  Fly   152 SR 153
            .:
Mouse   199 GQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 45/195 (23%)
Gatd1NP_742114.3 GATase1_Hsp31_like 12..216 CDD:153235 44/193 (23%)
ThiJ 31..204 CDD:223765 40/174 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.