DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dj-1beta and djr-1.1

DIOPT Version :9

Sequence 1:NP_651825.4 Gene:dj-1beta / 43652 FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_493696.1 Gene:djr-1.1 / 173416 WormBaseID:WBGene00015184 Length:187 Species:Caenorhabditis elegans


Alignment Length:184 Identity:101/184 - (54%)
Similarity:126/184 - (68%) Gaps:4/184 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KSALVIL-APGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFD 66
            ||||:|| |.||||||.||..|||.|..|:|..|||:|.|.|||:|...|:||..|..|.::|||
 Worm     4 KSALIILAAEGAEEMEVIITGDVLARGEIRVVYAGLDGAEPVKCARGAHIVPDVKLEDVETEKFD 68

  Fly    67 VVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQL 131
            :|:||||..|||.:.||.||.|:|:||...||||.||||||..|..||| ..:.:||:||:|.:|
 Worm    69 IVILPGGQPGSNTLAESLLVRDVLKSQVESGGLIGAICAAPIALLSHGV-KAELVTSHPSVKEKL 132

  Fly   132 -VNNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLV 184
             ...|.|.:|:.|| .|.:|||||||||:||||||.|.|.||:|...:...:|:
 Worm   133 EKGGYKYSEDRVVV-SGKIITSRGPGTAFEFALKIVELLEGKDKATSLIAPMLL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 99/178 (56%)
djr-1.1NP_493696.1 DJ-1_PfpI 4..169 CDD:280192 95/166 (57%)
not_thiJ 6..182 CDD:213612 98/177 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159839
Domainoid 1 1.000 172 1.000 Domainoid score I2233
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38295
Inparanoid 1 1.050 182 1.000 Inparanoid score I2638
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54253
OrthoDB 1 1.010 - - D1165707at2759
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - mtm4745
orthoMCL 1 0.900 - - OOG6_101257
Panther 1 1.100 - - LDO PTHR48094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1763
SonicParanoid 1 1.000 - - X2164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.