DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dj-1beta and Park7

DIOPT Version :9

Sequence 1:NP_651825.4 Gene:dj-1beta / 43652 FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001264178.1 Gene:Park7 / 117287 RGDID:621808 Length:214 Species:Rattus norvegicus


Alignment Length:188 Identity:87/188 - (46%)
Similarity:112/188 - (59%) Gaps:28/188 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKSALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASD-KF 65
            ||.||||||.||||||.:|..|::||||||||||||.|.:.|:|||||.|.|||||.:..:. .:
  Rat     3 SKRALVILAKGAEEMETVIPVDIMRRAGIKVTVAGLAGKDPVQCSRDVVICPDTSLEEAKTQGPY 67

  Fly    66 DVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQ 130
            ||||||||..|:..:.||:||.::|:.||:..||||||||.||.|..|.|..|..:||:|..|.:
  Rat    68 DVVVLPGGNLGAQNLSESALVKEILKEQENRKGLIAAICAGPTALLAHEVGFGCKVTSHPLAKDK 132

  Fly   131 LVN--------NYSYVDDKT----------------VVKDGNLITSRGPGTAYEFALK 164
            ::|        ..|:.|.||                |:||   ||:..|....:..:|
  Rat   133 MMNGSCSQDTEKSSWADLKTSSWCRAFVAQASGGRKVLKD---ITASPPCDGTDLPVK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 85/186 (46%)
Park7NP_001264178.1 GATase1_DJ-1 6..141 CDD:153229 74/134 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341747
Domainoid 1 1.000 174 1.000 Domainoid score I3573
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38295
Inparanoid 1 1.050 183 1.000 Inparanoid score I3864
OMA 1 1.010 - - QHG54253
OrthoDB 1 1.010 - - D1165707at2759
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - otm46301
orthoMCL 1 0.900 - - OOG6_101257
Panther 1 1.100 - - LDO PTHR48094
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.