DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dj-1beta and PARK7

DIOPT Version :9

Sequence 1:NP_651825.4 Gene:dj-1beta / 43652 FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001116849.1 Gene:PARK7 / 11315 HGNCID:16369 Length:189 Species:Homo sapiens


Alignment Length:186 Identity:98/186 - (52%)
Similarity:130/186 - (69%) Gaps:4/186 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKSALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASD-KF 65
            ||.||||||.||||||.:|..||:||||||||||||.|.:.|:|||||.|.||.||.....: .:
Human     3 SKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPY 67

  Fly    66 DVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQ 130
            ||||||||..|:..:.||:.|.::|:.||:..||||||||.||.|..|.:..|..:|::|..|.:
Human    68 DVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDK 132

  Fly   131 LVN--NYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLV 184
            ::|  :|:|.::: |.|||.::|||||||::||||.|.|.|.|||...:|...|::
Human   133 MMNGGHYTYSENR-VEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 95/179 (53%)
PARK7NP_001116849.1 not_thiJ 5..184 CDD:213612 95/179 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147889
Domainoid 1 1.000 171 1.000 Domainoid score I3745
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38295
Inparanoid 1 1.050 181 1.000 Inparanoid score I3996
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54253
OrthoDB 1 1.010 - - D1165707at2759
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - otm42153
orthoMCL 1 0.900 - - OOG6_101257
Panther 1 1.100 - - LDO PTHR48094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1763
SonicParanoid 1 1.000 - - X2164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.