DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dj-1beta and gatd1

DIOPT Version :9

Sequence 1:NP_651825.4 Gene:dj-1beta / 43652 FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001032195.1 Gene:gatd1 / 100148360 ZFINID:ZDB-GENE-051030-96 Length:213 Species:Danio rerio


Alignment Length:157 Identity:34/157 - (21%)
Similarity:64/157 - (40%) Gaps:46/157 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GGEAV----------KCSRDVQILPDTSLAQVAS---DKFDVVVLPGGLGGSNAMGESSLVGDLL 90
            ||:::          :..::..|.|..:.|::.|   .::..:::|...|..|.:..|..:..:|
Zfish    42 GGKSIDFTGVDDSTGRWVQEFSIKPYANPAKLESIDGARYQALLIPDCPGAMNDLAHSGSLARIL 106

  Fly    91 R---SQES-----GGGLIAAICAAPTVLAKHGVASGKSLTSYPSM-----------KPQLVNNY- 135
            .   ||:.     |.|:.|..||...   :..:.|..|:|. ||:           .|.:|.:: 
Zfish   107 SHFISQQKPVCAVGQGVAALCCATED---QKWIFSRYSMTG-PSVFELVRSSEFANLPLIVEDFI 167

  Fly   136 -----SY---VDDKT-VVKDGNLITSR 153
                 ||   ::|.. ||.|.:|||.:
Zfish   168 KDNGGSYTASIEDAVHVVLDRHLITGQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 34/157 (22%)
gatd1NP_001032195.1 GATase1_Hsp31_like 34..210 CDD:153235 34/157 (22%)
ThiJ <76..201 CDD:223765 28/123 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.