DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and Prkcq

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001263650.1 Gene:Prkcq / 85420 RGDID:620968 Length:707 Species:Rattus norvegicus


Alignment Length:419 Identity:128/419 - (30%)
Similarity:201/419 - (47%) Gaps:95/419 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   684 KVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAM 748
            |...|.:.::.:     |:.|..::|   |:|.  |:..|.:|.|:||:|.| ::...:...:|:
  Rat   355 KTAQPPEPEVNL-----QRASLQLKL---KIDD--FILHKMLGKGSFGKVFL-AEFKRTKQFFAI 408

  Fly   749 KTLRKADVLKRNQVAHVKAERDILAEA-DNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKL 812
            |.|:|..||..:.|.....|:.:|:.| ::.::..::.:||.|:||:|||:|:.|||||..:...
  Rat   409 KALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSC 473

  Fly   813 GIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYY 877
            ..|:...|.||.||:...:..:|..|.::||:|.||||:|||||||:.|||:|            
  Rat   474 HKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMC------------ 526

  Fly   878 QENGNHSRQDSMEPWEEYSEN--GPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQ 940
                              .||  |...|               ::..|||:|||||:|....|..
  Rat   527 ------------------KENMLGDAKT---------------NTFCGTPDYIAPEILLGQKYNH 558

  Fly   941 LCDYWSVGVILYEMLVGQPPFLANSPLETQQKV-------INWEKTLHIPPQAELSREATDLIRR 998
            ..|:||.||:|||||:||.||......|....:       ..|           |.|||.||:.:
  Rat   559 SVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRW-----------LEREAKDLLVK 612

  Fly   999 L-CASADKRLGKSVDEVKSHDFFKGIDFADMRKQK--APYIPEIKHPTDTSNFDPVDPEKLRSND 1060
            | ....:||||...| ::.|..|:.|::.::.:::  .|:.|::|.|.|.||||    ::..|..
  Rat   613 LFVREPEKRLGVRGD-IRQHPLFREINWEELERKEIDPPFRPKVKSPYDCSNFD----KEFLSEK 672

  Fly  1061 STMSSGD-----DVDQNDRTFHGFFEFTF 1084
            ..:|..|     .:|||     .|..|:|
  Rat   673 PRLSFADRALINSMDQN-----MFSNFSF 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 118/378 (31%)
S_TKc 719..1020 CDD:214567 101/311 (32%)
PrkcqNP_001263650.1 C1_1 160..212 CDD:278556
C1_1 232..284 CDD:278556
STKc_nPKC_theta 374..704 CDD:270770 124/395 (31%)
S_TKc 380..634 CDD:214567 101/311 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.