DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and TPK3

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_012755.1 Gene:TPK3 / 853688 SGDID:S000001649 Length:398 Species:Saccharomyces cerevisiae


Alignment Length:370 Identity:122/370 - (32%)
Similarity:193/370 - (52%) Gaps:70/370 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   696 RKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNH---LYAMKTLRKADVL 757
            :.||..::::      .|...|.|..|:.:|.|:||.|.|:    .|||   .||:|||:|..::
Yeast    71 KPMLQYRDTS------GKYSLSDFQILRTLGTGSFGRVHLI----RSNHNGRFYALKTLKKHTIV 125

  Fly   758 KRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARF 822
            |..||.|...||.:|:...:.::::::.:|||...::.|||||.||:|.|||.|...|...:|:|
Yeast   126 KLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKF 190

  Fly   823 YIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQD 887
            |.|||..|::.:|....|:||:||:|||:|::||||:||||.         :||..:        
Yeast   191 YAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGF---------AKYVPD-------- 238

  Fly   888 SMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILY 952
                                         :.::|.|||:||||||:....|.:..|:||.||::|
Yeast   239 -----------------------------VTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIY 274

  Fly   953 EMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCA-SADKRLG---KSVDE 1013
            |||.|..||..::.::|.:.::|.|  |..||  ....:|.||:::|.. ...:|||   ...::
Yeast   275 EMLAGYTPFYNSNTMKTYENILNAE--LKFPP--FFHPDAQDLLKKLITRDLSERLGNLQNGSED 335

  Fly  1014 VKSHDFFKGIDFADM--RKQKAPYIPEIKH-PTDTSNFDPVDPEK 1055
            ||:|.:|..:.:..:  |..:.||.|.|:. ..|||.||....|:
Yeast   336 VKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 119/349 (34%)
S_TKc 719..1020 CDD:214567 106/307 (35%)
TPK3NP_012755.1 STKc_PKA_like 86..376 CDD:270732 118/343 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.